KEGG   Paenibacillus psychroresistens: EHS13_32415
Entry
EHS13_32415       CDS       T06328                                 

Definition
(GenBank) DNA-directed RNA polymerase subunit delta
  KO
K03048  DNA-directed RNA polymerase subunit delta
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    EHS13_32415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ppsc03021]
    EHS13_32415
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_32415
Transcription machinery [BR:ppsc03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     EHS13_32415
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      EHS13_32415
SSDB
Motif
Pfam: HARE-HTH
Other DBs
NCBI-ProteinID: QGQ99234
UniProt: A0A6B8RTU7
LinkDB
Position
complement(7229298..7229897)
AA seq 199 aa
MSNQYTLKIPADQAKEMPMVDLAFIVLKAANTPFYYRDLMLEIAKIKGFSDDQVMQVIAQ
LYTEINVDGRFACVGSNLWGLKRWYPIDNKADDAMGNSKRPRIINDEDDDEEDLFAEEED
TYVAEEEDFDSFDRDREELVVEEEEEEELFAEDELADGELGETDLEESEDELGGELEEDS
DFEDDDSEEDEDDDEDDKK
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagtaaccaatacacactgaaaatacctgcagatcaagcaaaagaaatgccaatggtc
gatctagcttttatcgtgcttaaagcagccaatacgccattttattatcgcgatttaatg
ttggaaattgctaaaatcaaaggcttctccgacgatcaagtgatgcaagtcatcgcccaa
ctatatacggagattaacgtggatggaagattcgcatgtgtcggcagcaacctctggggc
ttgaaaagatggtatccgattgataacaaagcagacgatgctatgggcaactcgaaacgt
cctcgaatcattaatgatgaggatgacgatgaagaggatcttttcgctgaagaagaagat
acgtatgttgcagaagaagaggattttgattccttcgatcgcgatcgggaagagctagtc
gttgaagaagaggaagaagaagagttattcgctgaagatgaattggcagatggtgaattg
ggtgaaaccgatttagaagaatctgaagatgaattaggcggagaattagaagaggattct
gattttgaagatgatgattccgaagaagatgaagatgacgacgaggatgacaagaagtaa

DBGET integrated database retrieval system