KEGG   Paenibacillus psychroresistens: EHS13_32590
Entry
EHS13_32590       CDS       T06328                                 

Gene name
xth
Definition
(GenBank) exodeoxyribonuclease III
  KO
K01142  exodeoxyribonuclease III [EC:3.1.11.2]
Organism
ppsc  Paenibacillus psychroresistens
Pathway
ppsc03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ppsc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    EHS13_32590 (xth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ppsc03400]
    EHS13_32590 (xth)
Enzymes [BR:ppsc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.2  exodeoxyribonuclease III
     EHS13_32590 (xth)
DNA repair and recombination proteins [BR:ppsc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    AP endonucleases
     EHS13_32590 (xth)
SSDB
Motif
Pfam: Exo_endo_phos Exo_endo_phos_2 COMM_domain
Other DBs
NCBI-ProteinID: QGQ99266
UniProt: A0A6B8RVF8
LinkDB
Position
7272384..7273145
AA seq 253 aa
MKLVSWNVNGIRAAVKKGFSDYFRETNADIFCIQETKLQEGQISLEHAEEYSQYWNYAIT
KGYSGTAVFTKVKPLSVWYGLEEDSEPEGRVLTLEFAGFYLVNVYTPNARRDLSRLEFRV
DWEERFLGYLLKLDALKPVIICGDLNVAHHEIDIKNWKGNVGNSGFTPEERGKMTQLLDA
GFIDSFRHLYPEKTDAFSWWSNMPGVRARNVGWRIDYFLASSRLSSLITDAKIDQFILGS
DHCPIILEIAEIN
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagcttgtatcgtggaatgttaacggcataagagcagccgtaaaaaaaggtttttct
gattattttagagaaacgaacgcagatattttctgtatacaggaaacaaagctccaagaa
ggacaaatcagcttggaacatgctgaggaatattcacaatattggaattacgctattaca
aaaggctattcgggtacggccgttttcactaaagtgaaacctttgtctgtgtggtacggt
ttagaggaggatagcgagcctgaggggcgggttcttaccttggagtttgctggcttttat
ctagtaaatgtctatacgccaaatgctagacgcgatctctctaggctagaattccgtgta
gattgggaagaaagattccttggttatctcctgaagctagatgcacttaagcccgtaatc
atttgcggggatctgaatgtggctcatcatgagattgatattaagaactggaaaggcaat
gtcggcaattctgggtttacgccggaggaacgcggcaagatgactcagctgctagatgca
ggctttattgatagctttagacatctataccccgagaaaacagatgctttcagctggtgg
tctaatatgcctggtgttagagcgcggaatgtgggctggcggattgattatttcctagct
tcttcgagacttagttctttaattacggatgcaaaaattgatcaatttatactaggcagc
gatcattgcccgattatacttgagattgcagagattaattaa

DBGET integrated database retrieval system