KEGG   Pseudomonas putida KT2440: PP_3378Help
Entry
PP_3378           CDS       T00114                                 

Gene name
kguK
Definition
(RefSeq) 2-ketogluconokinase
  KO
K11441  dehydrogluconokinase [EC:2.7.1.13]
Organism
ppu  Pseudomonas putida KT2440
Pathway
ppu00030  Pentose phosphate pathway
ppu01100  Metabolic pathways
ppu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PP_3378 (kguK)
Enzymes [BR:ppu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.13  dehydrogluconokinase
     PP_3378 (kguK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 1047012
NCBI-ProteinID: NP_745518
UniProt: Q88HH9
LinkDB All DBs
Position
complement(3823239..3824189)
Genome map
AA seq 316 aa AA seqDB search
MHEHDVLCFGETMAMFVAEQAGDLAGVGQFGKRIAGADSNVAIGLARLGFKVRWLSRVGD
DSLGRFVLDSLRCEGLDCSGVEVDANYPTGFQLKARSEDGSDPAVEYFRRGSAASRLSAA
MVSPVWLQARHVHATGIPLALSDSCRALSHALLDGMRAAGRSISFDPNLRPSLWPDQSSM
VREINALAAKADWVLPGLEEGRLLTGQHTPADIAAFYLDQGVELVVIKLGDAGAYFRSAK
GEGQVAPVPVSRVVDTVGAGDAFAVGVLSALLEGRPVAEAVARGNWCGSRAVQSRGDMEG
LPLRHELEAYDLRRSA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcatgaacatgacgtgctgtgtttcggcgaaaccatggccatgttcgtcgccgagcaa
gccggtgacctggccggtgtcgggcagtttggcaaacgcatcgccggcgccgacagcaac
gtggcgatcggcctggcgcggctgggcttcaaggtgcgctggctgagccgggttggtgac
gattcgctgggccgtttcgtgctcgacagcttgcgctgcgaaggcctggactgttccggt
gtcgaggtggatgccaactacccgacgggctttcagctcaaggcccgcagcgaggatggc
agcgacccggcagtggagtactttcgccgcggttcggcggccagcaggctgtcagctgcg
atggtgagccccgtttggctgcaggctcgccacgtgcacgctaccggtattccgctggcg
ctgtcggacagctgtcgggcgctgtcccacgcgctgttggacgggatgcgcgcagccggt
cgcagcatatcgttcgaccccaacctgcgcccctcgctgtggcccgatcaaagcagcatg
gtgcgtgaaatcaatgccctggcggccaaggccgactgggttttaccggggctggaagag
gggcggttgctgaccggtcagcacaccccggccgatatcgccgcgttctacctggaccaa
ggggtggaactggtggtgatcaagctgggcgacgctggcgcctacttccgcagcgccaag
ggcgaagggcaggtagcccccgtgccagtcagccgcgtggtggacaccgtcggtgcaggt
gatgcctttgccgtcggtgtgctcagcgcgctactggagggccgtccggtagccgaggcg
gtagcgcgcggcaactggtgcggcagccgtgccgtgcagtcgcgtggcgacatggaaggg
ctgccgctgcgccatgagctggaggcctacgacctgcgcagaagcgcatga

DBGET integrated database retrieval system