Pectobacterium punjabense: E2566_12995 Help Entry E2566_12995       CDS       T06530                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ppuj  Pectobacterium punjabense Pathway ppuj00998   Biosynthesis of various antibiotics ppuj01100   Metabolic pathways ppuj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ppuj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     E2566_12995 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     E2566_12995 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1896 EutQ Motif Other DBs NCBI-ProteinID:  QJA20785 LinkDB All DBs Position complement(2856941..2857177) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVVNNASFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFIQANQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatcgttgaacagcttggtgttaagcag gaagaagtcgtaaacaatgcttctttcgttgatgacctcggcgctgattctcttgacact gttgagctggtaatggctctggaagaagaatttgatactgagattccagacgaagaagct gaaaaaatcacgactgttcaggcagccattgatttcattcaggctaaccagcagtaa

DBGET integrated database retrieval system