KEGG   Pandoraea pulmonicola: RO07_14255Help
Entry
RO07_14255        CDS       T03553                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ppul  Pandoraea pulmonicola
Brite
KEGG Orthology (KO) [BR:ppul00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RO07_14255
Enzymes [BR:ppul01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RO07_14255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO FAD_oxidored FAD_binding_3 HI0933_like Glutaredoxin NAD_binding_8 Thi4 K_oxygenase FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AJC21358
UniProt: A0A378Z3Q5
LinkDB All DBs
Position
1298713..1300299
Genome map
AA seq 528 aa AA seqDB search
MLDANLKAQLQTYLQKVTRPIEIAVWLDDSPKALEMKALVDEIAPLSPHIAVVPRDDANE
RRPSFAIGTPGEAPRIRFAGLPMGHEFTSLVLALLQVGGHPVKLDDDTIAQIRALDGDFR
FETYISLSCQNCPEVVQALNVMALINPRIQQVTIDGALFQGEVEARQVMAVPTVFLNGVS
FTQGRTSVKELLARLDTGASARAAKALENKPVYDMLIVGGGPAGAAAAIYAARKGISTGV
VAERFGGQVLDTMAIENFVSVTHTEGPKFATALEQHVKTYDVDVIDAQRAEALMPGKVHE
VRLASGAVLKARAVVLATGARWREIGVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLVEYGTQLRADEVLQRKLRSLPNVRVLTNAQTTEITGDGQKV
NGLAYVERASGESRTLALEGVFVQIGLVPNTEWLKGTLALSRHGEIEVDAKGATSVPGVF
AAGDVTTVPFKQIVIALGEGAKASLGAFEHLMLSSIEDEARAPQAIAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcgaacctcaaagcccagttgcaaacgtacctccagaaagtcacgcgcccg
atcgagatcgccgtgtggctcgacgacagcccgaaggcgctcgagatgaaggcgctggtc
gacgagatcgcgccgctctcgccgcacatcgccgtggtgccgcgcgacgatgcgaacgag
cgccgtccgtcgttcgccatcggcacgccgggcgaggcgccgcgcatccgtttcgccggg
ctgccgatgggccacgagttcacgtcgctggtgctggcgctgctgcaggtcggcgggcat
ccggtcaagctcgatgacgacaccatcgcgcagatccgagccctcgacggcgatttccgc
ttcgagacctacatctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctcaac
gtgatggcgctcatcaatccgcgcatccagcaggtcactatcgacggcgccctgttccag
ggcgaagtcgaagcgcgtcaggtgatggcggtgccgacggtgttcctcaatggcgtgtcg
ttcacgcaaggccgcaccagcgtgaaggaactgctcgccaggctcgacacgggcgcgagt
gcgcgcgccgccaaggcgctggagaacaagccggtctacgacatgctgatcgtcggtggt
ggtcctgcgggggctgcggcagcgatttacgccgcacgaaagggcatctcgacaggggtg
gtcgccgagcgtttcggcggtcaggtgctcgacacgatggccatcgagaatttcgtctcc
gtcacgcacaccgaaggaccgaagttcgcgacggcgctcgagcagcacgtgaagacctac
gacgtcgacgtgatcgacgcgcaacgcgcagaagcgttgatgccgggcaaggtccacgag
gtgcgcctggccagcggcgcggtgctcaaggcccgtgcggtcgtgctggccacgggcgcg
cggtggcgcgaaatcggcgtgccgggcgagcgcgagtatcgcaaccgcggcgtggcctat
tgcccgcactgcgacgggccgctcttcaagggcaagcgcgtcgccgtcgtcggaggtggc
aactcgggcgtcgaagcggcgatcgatctggcgggcatcgtcaaggaagtcacgctcgtc
gaatacggcacgcaactgcgcgccgacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgcgcgtgctgacgaatgcgcaaaccactgaaatcactggcgacggccagaaggtg
aacggcctcgcgtatgtcgagcgcgcgtcgggcgaatcgcgcaccctcgcgctcgaaggc
gtgttcgtgcagatcggccttgtgcccaacaccgaatggctcaagggcacgctggcgctg
tcgcgtcacggagaaatcgaagtggacgccaagggcgcgacctcggtgccgggcgtgttc
gccgcgggcgacgtgacgaccgtgccgttcaagcagatcgtgatcgcgctcggggagggc
gcgaaggcgtcgctcggcgcgttcgaacacctgatgctcagttccatcgaggatgaggcg
agggcaccgcaggccatcgccgcttga

DBGET integrated database retrieval system