KEGG   Pseudomonas putida NBRC 14164: PP4_11710
Entry
PP4_11710         CDS       T02707                                 

Definition
(GenBank) peptidase M48 family protein
  KO
K01423  beta-barrel assembly-enhancing protease [EC:3.4.-.-]
Organism
ppun  Pseudomonas putida NBRC 14164
Brite
KEGG Orthology (KO) [BR:ppun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ppun01002]
    PP4_11710
Enzymes [BR:ppun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     PP4_11710
Peptidases and inhibitors [BR:ppun01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   PP4_11710
SSDB
Motif
Pfam: Peptidase_M48 TPR_19 TPR_14 TPR_16 TPR_11 TPR_6 TPR_17 NARP1 TPR_20 TPR_21 HrpB1_HrpK Peptidase_M78
Other DBs
NCBI-ProteinID: BAN53024
LinkDB
Position
complement(1350046..1351482)
AA seq 478 aa
MNLLRPTLLTLACLMALPGHADDLPSLGDASSAIVSPQQEHQLGRAWLSLLRGQVNQLND
PQLKDYVETTVYRLAETSQLQDRRLEFILIDSRELNAFAAPGGIVGVNGGLFLNARTEGE
YASVLAHELAHLSQRHFARGVEAQQRMQLPMMAALLAGIVLAAGGAGDAGIGMIAGTQAA
AIQEQRRFSRQNEQEADRIGIQNLEKAGYDPRNMPTMFERLAQQYRYGAKPPEFLLTHPV
TESRIADTRNRAEQAPKGGVEDSQRYQLIRARVALTYEETPGLAAKRFRSQLDEDPKLDA
ARYGLALAQIKGGQLNEARENLKPLLAKAPNDITYNLAQIDLDITNNRLADAQQRAERMQ
GLYPGNYPLKQVRADLLVKQSKPTEAEKILNELIKSRPDDPDVWYDMAEVRGLSGNTIGL
HRARAEFFTLVGDFDQAIQQLDYAKRRAGGNFPLASQIDQRQREILEQQRMVREMMGR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgaatctactgcgccctaccctgctgacgctggcctgcctgatggcccttcccggccat
gctgacgacctgccatcactgggtgacgccagctctgcgatcgtctcgccgcaacaggag
catcaactgggccgtgcctggctgagcctgctgcgtggccaggtcaaccagttgaacgac
ccgcagctcaaggactacgtcgagactaccgtgtaccgcctggccgaaaccagccagctg
caggaccggcgcctggaattcatcctgatcgacagccgtgaactcaacgccttcgcggcc
cccggcggcatcgtcggggtcaacggcggcctgttcctcaatgcccgcaccgaaggcgaa
tacgcctcggtgctggcgcacgaactggcgcacttgtcgcaacgccacttcgcccgcggc
gtcgaagcccagcaacgcatgcaactgccgatgatggcggctttgctcgcgggtatcgtg
ctggctgccggtggcgctggcgatgcgggtatcggcatgattgccggcacccaggcggcg
gcaatccaggaacagcggcgtttctcgcggcagaacgaacaggaagccgaccgcatcggc
atccagaaccttgaaaaggccggttacgacccgcgcaacatgcccaccatgttcgaacgc
cttgcgcagcagtaccgctacggcgccaagccgccggaatttctgctgactcacccggtg
accgaatcgcgtatcgctgacacccgcaaccgtgccgaacaggcgcccaagggcggtgtc
gaggacagccagcgctatcagctgattcgcgcgcgcgtggccctgacctatgaagaaaca
cccggcctggcagccaagcgcttccgctcccaactcgacgaagacccgaaacttgacgct
gcacgctatggcctggccctggcgcaaatcaagggcggccagctgaacgaagcgcgcgaa
aacctgaagccgttgctggccaaggcccccaacgacatcacctacaacctggcgcagatc
gacctggacatcaccaacaaccgcctggccgacgcgcagcagcgggccgagcggatgcag
gggctgtacccgggcaactacccgcttaaacaggtgcgtgccgatctgctggtgaagcag
agcaagccgaccgaggcggagaagatattgaacgagctgatcaagagccggccggatgac
ccggacgtctggtacgacatggctgaagtgcggggtttgtcgggcaataccattggcttg
caccgggctcgagccgagttcttcacgttggtaggggactttgaccaggcgatccagcag
ctggattacgccaagcgccgggcgggcggcaacttcccgctggcgtcgcagatcgaccag
cgccagcgcgagatcctggagcagcagcgtatggttcgggaaatgatggggcgctga

DBGET integrated database retrieval system