Pseudomonas parafulva: NJ69_20300 Help Entry NJ69_20300        CDS       T03520                                  Name (GenBank) glutaredoxin   KO K03676   glutaredoxin 3 Organism ppv  Pseudomonas parafulva Brite KEGG Orthology (KO) [BR:ppv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ppv03110]     NJ69_20300 Chaperones and folding catalysts [BR:ppv03110]  Protein folding catalysts   Protein disulfide isomerase    NJ69_20300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Thioredoxin_2 Glrx-like Thioredoxin_4 GST_N DSBA SH3BGR Motif Other DBs NCBI-ProteinID:  AIZ35175 UniProt:  A0A0A7JUH8 LinkDB All DBs Position 4647319..4647573 Genome browser AA seq 84 aa AA seqDB search MQPVIVYSSDYCPYCMRAKQLLASKNVAFEEIRVDGKPQLRAEMAQKAGRTSVPQIWIGS THVGGCDDLFALERSGKLDALLEA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaccggtcatcgtctattccagcgactactgcccctactgcatgcgcgccaagcaa ctgcttgcgagcaagaacgtggccttcgaggaaatccgtgtcgacggcaagccgcaactg cgtgccgagatggcgcagaaggccgggcgtacctcggtgccgcaaatctggattggcagc acccatgtcggcggttgcgatgacttgtttgcgctggagcgctcgggcaagctcgacgcc ctgctcgaggcctga

DBGET integrated database retrieval system