KEGG   Pseudomonas poae: H045_04280Help
Entry
H045_04280        CDS       T02456                                 

Gene name
fadB
Definition
(GenBank) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ppz  Pseudomonas poae
Pathway
ppz00071  Fatty acid degradation
ppz00280  Valine, leucine and isoleucine degradation
ppz00281  Geraniol degradation
ppz00310  Lysine degradation
ppz00362  Benzoate degradation
ppz00380  Tryptophan metabolism
ppz00410  beta-Alanine metabolism
ppz00640  Propanoate metabolism
ppz00650  Butanoate metabolism
ppz00903  Limonene and pinene degradation
ppz00930  Caprolactam degradation
ppz01100  Metabolic pathways
ppz01110  Biosynthesis of secondary metabolites
ppz01120  Microbial metabolism in diverse environments
ppz01130  Biosynthesis of antibiotics
ppz01200  Carbon metabolism
ppz01212  Fatty acid metabolism
Module
ppz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    H045_04280 (fadB)
   00650 Butanoate metabolism
    H045_04280 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    H045_04280 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    H045_04280 (fadB)
   00310 Lysine degradation
    H045_04280 (fadB)
   00380 Tryptophan metabolism
    H045_04280 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    H045_04280 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    H045_04280 (fadB)
   00281 Geraniol degradation
    H045_04280 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H045_04280 (fadB)
   00930 Caprolactam degradation
    H045_04280 (fadB)
Enzymes [BR:ppz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     H045_04280 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     H045_04280 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     H045_04280 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     H045_04280 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AGE24932
LinkDB All DBs
Position
917611..919758
Genome map
AA seq 715 aa AA seqDB search
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDTLKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPDAELVAGNLEANKIFSDFEDLNVPTVAAINGIALGGGLE
MCLAADFRVMSATAKVGLPEVKLGIYPGFGGTVRLPRLIGADNAIEWIAAGKENNAEDAL
KVGAVDAVVAPDKLAEAALSLIKGAISGEFDYKAKRQPKLEKLKLNAIEQMMSFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFVKLAKTSAAQSLIGLFLNDQEL
KKKAKAYDEIAKDVKQAAVLGAGIMGGGIAYQSASKGTPILMKDINEHGIEQGLAEAAKL
LVGRVDKGRMTAAKMAEVLNGIRPTLSYGDFGHVDLVVEAVVENPKVKQAVLAEVEAQVK
DDTILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSELAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDALYEAKRLGQKNGKGFYAYEADKKGKQ
KKVADPSVHEVLAPVIYEQREVSDEDIVNWMMIALCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADKYAELGPLYHPTAKLREMAKNGQSFFG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aaattcgacctcaagggtgagtccgtcaacaagttcaaccgtctaaccctgaatgaactg
cgtcaggccgtagacaccctcaaagcggatgcttcggtcaagggcgtgatcgtctccagc
ggcaaggacgtgtttatcgtcggcgctgacatcaccgaattcgtcgacaacttcaagctg
cccgatgcggagcttgtggccggcaacctcgaagccaacaagattttcagcgatttcgaa
gacctcaacgtacccaccgttgccgcgattaatggcattgcgctgggcggcggcctggaa
atgtgcctggcggcagattttcgcgtgatgtcggccaccgccaaagtcggcctgcccgaa
gtcaagctgggcatctacccaggcttcggtggcaccgtgcgcctgccgcgcctgatcggt
gccgacaacgccatcgagtggatcgccgccggcaaggaaaacaatgctgaagacgccctg
aaagtcggtgccgtcgatgccgtggttgccccggacaagctggctgaagctgcactgagc
ctgatcaagggcgccatcagcggcgaatttgactataaggccaagcgtcagccgaagctg
gaaaaactcaagctcaacgccatcgagcaaatgatgtcgttcgaaaccgccaaaggtttc
gtggcaggtcaggccggcccgaactacccggcaccggttgaagcgatcaagaccatccag
aaagccgcgaacttcggtcgcgacaaagctctggaagtggaagcggccggtttcgtcaaa
ctggcgaaaacctccgctgcccagagcctgatcggcctgttcctgaacgatcaggaactg
aagaaaaaggccaaggcctacgacgagatcgccaaggacgtgaaacaggctgctgtgctc
ggcgccgggatcatgggcggcggtatcgcctatcagtcggcgtccaagggcacgccgatc
ctgatgaaagacatcaacgaacacggtatcgagcaaggcctggcggaagccgccaagctg
ctggtcggccgcgtggacaaaggtcgcatgaccgccgcgaaaatggctgaagtgcttaac
ggcattcgtcctacgctgtcctacggtgacttcggtcacgtcgatctggtggtcgaagcc
gtcgttgaaaatccgaaggtcaagcaggccgtactggccgaagtggaagctcaggtcaag
gacgacacgatcctggcctccaacacctcgaccatttccatctcgctactggctcaggcc
ctcaagcgtccggaaaacttcgtcggcatgcacttcttcaacccggtgcacatgatgccg
ctggtggaagtgattcgtggcgaaaagtccagcgaactggcggttgccaccaccgtggcc
tacgccaagaaaatgggcaagaatccgattgtggtcaatgactgcccgggcttcctggtc
aaccgcgtgctgttcccgtacttcggtggtttcgccaagctggtcagcgctggcgtggac
tttgtgcgtatcgacaaggtgatggaaaaattcggctggcccatgggccctgcgtacctg
atggacgtggtcggcatcgacaccggccaccacggtcgcgacgtgatggctgaaggcttc
ccggaccgcatgaaagacgaccgccgttcggcgatcgacgcgctctacgaggccaagcgc
ctgggccagaagaacggcaagggcttctacgcctacgaggccgacaagaagggcaagcag
aagaaagtggccgacccgtcggtgcacgaagtgctggcgccggtcatctacgagcagcgt
gaggtgtccgacgaggacatcgtcaactggatgatgatcgccctgtgcctggaaaccgtg
cgttgcctggaagacggcatcgtcgaaaccgccgccgaagccgacatgggcctggtgtac
ggcattggtttccctccgttccgtggcggtgcgttgcgttacatcgactcgatcggtgtg
gccgagttcgttgccctggctgacaaatacgctgagctgggcccgctgtaccacccgacc
gcgaagctgcgtgagatggccaaaaatggccagagcttcttcggttaa

DBGET integrated database retrieval system