KEGG   Pradoshia sp. D12: F7984_15355
Entry
F7984_15355       CDS       T06218                                 

Definition
(GenBank) GAF domain-containing protein
  KO
K08968  L-methionine (R)-S-oxide reductase [EC:1.8.4.14]
Organism
prd  Pradoshia sp. D12
Pathway
prd00270  Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:prd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    F7984_15355
Enzymes [BR:prd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.14  L-methionine (R)-S-oxide reductase
     F7984_15355
SSDB
Motif
Pfam: GAF_2 GAF GAF_3
Other DBs
NCBI-ProteinID: QFK73337
UniProt: A0A5J6XSY4
LinkDB
Position
3199004..3199483
AA seq 159 aa
MFQVGKYKKTKPENYQMVSKQLEALIDGETNLIANLSNASALLNQFLDDVNWVGFYLYEE
EQLILGPFQGLPACIRIPLGKGVCGTAAEKREIIRVMDVHQFPGHIACDAATQSEIVLPI
LKDGRLIGVLDIDSPSKNRFDKEDEHGLKQFVDILVQSI
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtttcaagtcggaaaatataaaaaaacgaaaccagaaaactatcaaatggttagcaaa
cagctggaagccctaatagatggtgaaacaaatttaattgccaatttgagcaatgcttct
gcccttttaaatcaatttttggacgacgtgaactgggtaggattctacctatatgaagag
gagcaactgatacttggaccatttcaaggtctcccagcctgcattcgaattcctttaggc
aagggagtatgcggaacagcggcagaaaaaagagaaataatcagggtaatggacgtacat
caattccctggacacatcgcctgtgatgctgccactcaatcagaaatcgttttgccgatt
ctgaaggatggccgtctgattggtgtacttgatatagacagtccatcaaagaatcgtttt
gacaaagaagatgaacatggattaaaacaatttgttgatatacttgtccaatcaatttaa

DBGET integrated database retrieval system