KEGG   Pseudomonas resinovorans: PCA10_p0280
Entry
PCA10_p0280       CDS       T02708                                 

Gene name
carAa
Definition
(GenBank) carbazole 1,9a-dioxygenase terminal oxygenase
  KO
K15751  carbazole 1,9a-dioxygenase [EC:1.14.12.22]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00621  Dioxin degradation
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01220  Degradation of aromatic compounds
Module
pre_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PCA10_p0280 (carAa)
Enzymes [BR:pre01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.22  carbazole 1,9a-dioxygenase
     PCA10_p0280 (carAa)
SSDB
Motif
Pfam: Aromatic_hydrox Rieske VanA_C
Other DBs
NCBI-ProteinID: BAN51412
UniProt: S6AKJ2
LinkDB
Position
pCAR1.3:28487..29641
AA seq 384 aa
MANVDEAILKRVKGWAPYVDAKLGFRNHWYPVMFSKEIDEGEPKTLKLLGENLLVNRIDG
KLYCLKDRCLHRGVQLSVKVECKTKSTITCWYHAWTYRWEDGVLCDILTNPTSAQIGRQK
LKTYPVQEAKGCVFIYLGDGDPPPLARDTPPNFLDDDMEILGKNQIIKSNWRLAVENGFD
PSHIYIHKDSILVKDNDLALPLGFAPGGDRKQQTRVVDDDVVGRKGVYDLIGEHGVPVFE
GTIGGEVVREGAYGEKIVANDISIWLPGVLKVNPFPNPDMMQFEWYVPIDENTHYYFQTL
GKPCANDEERKNYEQEFESKWKPMALEGFNNDDIWAREAMVDFYADDKGWVNEILFEVDE
AIVAWRKLASEHNQGIQTQAHVSG
NT seq 1155 nt   +upstreamnt  +downstreamnt
gtggcgaacgttgatgaggcaattttaaaaagagtaaaaggctgggcgccctacgtggat
gcgaagctaggctttcgcaatcattggtacccggtgatgttttcgaaagagatcgacgag
ggcgagccgaagacactaaaactgctcggtgagaacttgctcgtcaatcgtatcgatggg
aagctgtattgcctcaaggaccgctgcctgcatcgcggcgtccagttgtcggtcaaagtc
gagtgcaaaacgaagtcgacgatcacatgctggtaccacgcgtggacctatcgctgggaa
gacggcgttctgtgcgacatcttgacgaatccgacaagcgcacagatcggtcgacaaaag
ctgaaaacttacccagtgcaggaagccaagggctgcgtcttcatttatcttggcgatggc
gaccctcctcccttggcccgcgatacgccacccaatttccttgacgatgacatggaaatc
ctcgggaagaaccaaatcatcaagtctaactggcgcctcgctgtggaaaacggtttcgat
ccgagccacatttatattcacaaagactcaattctggtcaaggacaacgatcttgccttg
ccactaggtttcgcgccaggaggggatcgaaagcaacaaactcgtgtggttgacgatgac
gtcgtcggacgcaagggtgtttacgatcttattggcgaacatggggtcccagtgtttgag
ggaactatcgggggcgaagtggtccgcgaaggtgcctacggcgaaaaaattgtagcgaac
gatatctccatttggctcccgggtgttctcaaggtcaatccgttccccaatccggacatg
atgcagttcgagtggtacgtgccgattgacgaaaacacacactattacttccaaactctt
ggcaaaccatgtgccaatgacgaggaacggaagaattacgaacaagagttcgaaagcaag
tggaaaccgatggcgctcgaaggattcaacaacgatgacatctgggctcgcgaagctatg
gtggatttctacgccgatgataaaggctgggtcaacgagattttgttcgaggtggacgag
gctatcgtggcatggcgcaagctggcgagcgaacacaatcagggtattcagacccaagcg
cacgtttcgggctga

DBGET integrated database retrieval system