KEGG   Poecilia reticulata (guppy): 103472821
Entry
103472821         CDS       T05149                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pret  Poecilia reticulata (guppy)
Pathway
pret04141  Protein processing in endoplasmic reticulum
pret04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:pret00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103472821 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103472821 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pret03000]
    103472821 (atf6b)
Transcription factors [BR:pret03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103472821 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 YabA MCU bZIP_Maf CENP-H
Other DBs
NCBI-GeneID: 103472821
NCBI-ProteinID: XP_008420883
LinkDB
Position
LG11
AA seq 695 aa
MTADLLSDLDSRFFADNLLTSEDWDACLFKCESMEEGEDGDFSXGLKYEPSVRSCFCLGN
TSVIKNEMTLTEPLPVEMLFQVKAEPPSPASSLESDCSTLSPDPQVTIKAENPPTPPYMY
GDVLSPPLGTMEVTVATTAVPPPQSQIPIMTQTQLQAPLTSVQAVINGIQTQTAVLPSTL
KASSILSTKPPIQPRPVCVAASLPVPQNPAPAKTLILQGLPSMDQNRPVVLSPSVCLSSA
PAIVKMEPVSPSIPQHCSSPTASSTSKPIVPATTALPSNNSNDIDMKVLKRQQRMIKNRE
SACQSRKKKKEYLQNLEAQLREAQQENERLRRENQALRERLAVKESSDSASNKRAVCVMA
VLLFMTFSFGPVSITDRKLSAGLQEDLVSYTGRRLLEIEQQQERQADPQPLQKIEDKQEK
PESGGDERWKGGEAERYAPESYQFRNLSDMFSDMKDLVLPDIERYFTSSDCRQFNRSESL
RLADELRGWVHRHQIDRKKSGGKAKTAKKAKITQKAQLRKANISRYLPIQAHRSIESQLR
VLPGPEVTYSDFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMSVNES
LYNSSQGYEMMMQVDCEVMDTRIVPIKSSAVPPSLRDPTPPPPASQHGAHHHHGNNTSLR
GRHQHHPSSSSPSPRQPLPSRTQTPEYLISQSEGV
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgactgcggatttactgtctgatctggatagccgattcttcgctgataacctactgacg
agcgaagattgggatgcctgcctgttcaagtgtgagagcatggaggaaggagaggacggg
gacttcagtmaagggttgaaatacgaaccatcggtacggtcatgtttctgtttaggaaac
acttcggtgataaaaaatgagatgacattgacggagccgctccctgtggaaatgttgttc
caggtcaaggctgagcctccctctcctgcttcctcgctggagtcggattgttcgaccttg
tcgcctgacccacaggttacaattaaagccgaaaaccctccgactcctccgtacatgtat
ggagacgtactgtctcctccgctggggacgatggaggtaaccgtggcaacgacagcagta
cccccaccccagtcccagattccaataatgacacagactcagctgcaggcaccattaaca
tctgtccaagcagtcatcaatggaatacagacacaaactgcagtcctgccaagcacatta
aaagccagcagcatcctgagcaccaaacctcccatccagccccgaccggtgtgtgttgct
gcttcactccccgtcccccaaaaccctgcaccagcgaagaccctcatactgcaggggctg
ccctccatggatcagaacagacctgtcgtcctctctccgtccgtctgtctcagttcggct
ccggctattgtcaaaatggaacctgtgtcccccagcatccctcagcactgctccagccca
actgcctcctcaaccagcaagcccatcgtcccggcgaccacggcgttgcccagcaacaac
tccaacgacattgatatgaaggtgctaaagcggcaacagaggatgataaagaaccgagag
tctgcctgccagtcgagaaagaaaaagaaggaatacctgcagaacctggaggcycagctg
agggaagcacagcaggagaacgaacgactccgcagggagaaccaggcgctgagggagaga
ctggctgtgaaggagagcagcgactctgcaagcaacaagagagcagtgtgtgtcatggcg
gttctgctgttcatgaccttcagctttggccccgtcagcatcacagacaggaagctgtcg
gccggtctgcaggaagatctggtgtcgtatacgggtcgccggctgctggagatcgaacag
cagcaggagcgccaggctgatcctcaacctctccagaaaattgaggacaaacaggagaaa
ccggagtccggcggcgacgagcggtggaagggaggagaggcggagagatacgctccagag
tcttatcagttccgaaacctgagtgacatgttcagtgacatgaaggatctggttctgcca
gacatcgagcgttacttcacttcctcagactgccgacagttcaaccgctctgagtctctc
aggcttgcagacgagctgagaggttgggttcatcgacatcaaatcgacaggaagaagtct
ggaggaaaagcaaagacggccaaaaaagcaaagatcacccagaaagctcaactgaggaag
gcaaacatctccagatatctgccgatccaggctcaccgctccatagaaagtcagctgagg
gtacttcctggtcctgaggtcacctacagcgacttcctggacgccatcgaccgcagggaa
gacacgttctacgtcgtgtctttcaggagggaccacctgttacttcctgccatcagccac
aacaaaaccagccgscctaaaatgtctctggtgatgccggccatgtctgttaacgagagt
ctctacaactcgtctcagggctacgagatgatgatgcaggtcgactgcgaggttatggac
actcgcatcgtccccataaagtcctctgccgtccctccgtctcttcgcgaccccacccct
cctccgcccgcctcccagcacggcgcccaccatcaccatggcaacaacacctccctcaga
gggcggcaccagcaccatccatcgtcttcttccccgtctccaaggcagcctctgccctcc
cgaactcaaacacccgaatacttgatcagccaatcagaaggcgtctga

DBGET integrated database retrieval system