KEGG   Providencia rustigianii: NCTC6933_01878Help
Entry
NCTC6933_01878    CDS       T06047                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prj  Providencia rustigianii
Brite
KEGG Orthology (KO) [BR:prj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC6933_01878 (ahpF)
Enzymes [BR:prj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC6933_01878 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_binding_3 AlaDh_PNT_C DAO FAD_oxidored Thi4 Glutaredoxin NAD_binding_8 K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: VEB69725
LinkDB All DBs
Position
1:1883994..1885568
Genome map
AA seq 524 aa AA seqDB search
MLDNNLQAQLKAYLEKLTKPVELVANLDDSEKSNEIKQLLEQIASLSEMVSMRVEQNSAL
RTPSFLITNPGTNIGVRFAGSPLGHEFTSLVLALLQVGGHPSKEAQELLDQVKSLDGDFH
FETYYSLSCHNCPDVVQALNLMAVLNPNISHTAIDGALFQNEIDERNIMGVPAVFLNGKE
FGQGRMTLSEIVSKVDTNADARAAKSLSEREPFEVLIIGSGPAGASAAVYTARKGIRTGM
VGERFGGQVMDTVDIENYISVLKTEGAILAGALKNHVDSYNVDVIDGQSVTKLIPAEHVG
GYHQIETASGGVMKARSIIIATGARWRNMGVPGEQEYRTKGITFCPHCDGPLFKGKRVAV
IGGGNSGIEAAIDLAGIVEHVTVLEFASELKADSVLQEKARSLGNIDIILNAQTLEVKGD
GSKMTSLEYKDRTDDSVHSLEVAGAFVQIGLLPNTNWLGDTVARNRMGEIEIDARNETNV
KGVFAAGDCTTVPYKQIIISAGEGAKAALSAFDYLIRTSTRTAE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataataatttacaggcgcaattaaaagcctatctagaaaaattaaccaaaccc
gtagaattagttgcaaatttagatgacagcgaaaaatctaacgaaataaaacaattactt
gaacaaattgcttcgttgtctgagatggtgtctatgcgtgtagagcaaaatagcgctttg
agaacaccatcattcttaatcaccaacccagggaccaatattggcgtgcgctttgcaggc
tctccattgggccatgaatttacctctttggttctggctctactgcaagtcggtggacat
ccatccaaagaagcccaagaattattggatcaggtgaaaagcttagacggcgattttcac
tttgagacttattattcattatcttgccataactgtccggatgtcgttcaggcgctaaac
ttgatggcagttctgaatccaaacatctcacacacggcaattgatggtgcattatttcaa
aatgaaatcgacgaacgcaacatcatgggtgttccagccgttttcttaaatggtaaagag
tttggccaaggccgcatgacactgagtgaaattgttagcaaagttgatactaatgctgat
gcccgcgccgcgaaatcgctcagtgaacgtgaaccatttgaagtgctaattattggtagt
ggtcctgctggcgcttcggcagcggtatatactgcacgtaaaggcatccgtacgggtatg
gtcggtgagcgttttggtggccaagttatggatactgtagatatcgaaaactatatttcg
gtattgaaaacagaaggggccattttagcaggtgccctgaagaatcatgtagatagttat
aatgtggatgtcattgatggccagtctgtgactaaattaatccccgcagaacatgtgggt
ggctatcatcaaattgaaactgcctccggtggtgtgatgaaagcacgcagtattattatt
gcaacaggagcccgctggagaaatatgggtgtaccgggtgagcaagaataccgcaccaaa
ggtatcactttctgcccacactgcgatggcccattatttaaaggcaaacgcgtggctgta
atcggcggtggtaactctggtattgaggctgcaatcgacttagcgggtatcgttgagcat
gttacggttcttgagtttgcttcagaattaaaagctgactcagtgttacaagaaaaagca
cgaagcttaggtaatatcgatattattttaaatgctcaaacccttgaagtgaaaggggat
ggcagcaaaatgactagcttagagtataaagaccgtaccgatgacagtgtacattcttta
gaggttgctggggcattcgttcaaattggcttgttaccaaatacaaattggttaggcgat
acagttgctcgtaaccgtatgggcgaaatagaaattgatgcacgtaacgaaaccaatgta
aaaggtgtattcgctgcgggcgactgtactacagtgccatataaacaaattatcatttca
gccggagaaggtgcaaaagccgcacttagcgcatttgactacctaatccgcactagtacc
agaaccgctgaatag

DBGET integrated database retrieval system