KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_2235Help
Entry
PsycPRwf_2235     CDS       T00541                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
prw  Psychrobacter sp. PRwf-1
Brite
KEGG Orthology (KO) [BR:prw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PsycPRwf_2235
Enzymes [BR:prw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PsycPRwf_2235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like Thioredoxin_3 DAO FAD_binding_2 AlaDh_PNT_C Thi4 NAD_binding_8 FAD_oxidored K_oxygenase NAD_binding_7 FAD_binding_3 Lycopene_cycl 3HCDH_N Glutaredoxin PALP DSBA zinc_ribbon_9
Motif
Other DBs
NCBI-ProteinID: ABQ95175
UniProt: A5WHN4
LinkDB All DBs
Position
complement(2775634..2777214)
Genome map
AA seq 526 aa AA seqDB search
MLDQGLLDAVKSYSENMTHPIRFVIGQGDHPKKAELVDFLKQIAGTTDKINFDDAATDDS
LPSPISFKIISEKDSGHNETGIVFSGIPGGHEFTSLILAILQAGGHTLKLDDSIQKMVKR
IAQPLQFQTYVSLSCHNCPEVVQALNQFALLNDGISNEMIDGGLFQEQVEANNIQGVPAV
FLNGKPFLNGKVDTARIIDKLQEQYPDLLAAPSEDDAEQLERQDVTVIGGGPAGVASAIY
SARKGLKVTIVADRIGGQVKDTQSIENLISVPLTTGSELSANFEKHLAEYDITIKEHVSV
KQLSETEDENYRIQLNTSEQFETRSIIIATGAQWRKLNVPGEEENIGSGVAYCPHCDGPF
FKSKDIAVIGGGNSGIEAALDLAGIVKNVTVFEFADDLKADQVLINKAKSIDNINIITSA
ATKEIKATDGKVTSIVYEDRTTGDIKEQDLSAVFVQIGLVPNSDFVKGFVDVNRFGEIEI
DEACKTDRRGIFAAGDVTTVPFKQINIAMGEGSKAALSAFEYLVMQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaggtttattagatgcagtaaaaagttacagtgaaaatatgactcacccc
attcgcttcgtgatcggtcaaggtgaccatcccaaaaaagccgaattggtagacttttta
aagcagattgccggtaccaccgacaaaattaactttgatgacgctgcgaccgatgacagc
ttacctagcccaattagcttcaagattatctctgaaaaagacagtggccataatgagaca
ggtatcgtatttagcggtatcccaggcgggcatgagtttacttcactaattttagccatc
ttacaagccggtggtcacacgctgaagcttgatgacagcatccaaaaaatggtgaagcgt
atcgctcagcccttacagttccaaacttacgtttcattgtcatgccacaactgtccagag
gttgtacaagcattaaaccagtttgccttattaaatgacggcatcagcaatgagatgatt
gatggtgggctgttccaagagcaagtagaagccaacaacattcaaggcgtgccagcggta
tttttaaacggcaaacccttcttaaatggtaaagtagatacggcacgtatcattgataag
ctacaagaacagtatccggatttattggccgcacccagtgaagatgatgctgaacagtta
gagcgtcaagatgtgacggtcatcggtggtggcccagcaggggtggcatcagccatctac
agcgcacgtaaaggtctgaaagttaccatcgttgctgatcgtattggcggtcaagtgaag
gatacccaaagtattgagaacttaatctccgtgcctttaactaccggcagcgagctgtca
gcaaactttgaaaaacacttggctgaatatgacattaccattaaagagcacgtcagtgtg
aaacagctgagtgaaacggaagatgagaactaccgcattcaattaaataccagcgagcag
tttgaaacgcgcagtattattattgcaaccggtgctcagtggcgtaagctaaatgtaccg
ggtgaagaggagaacatcggtagcggtgtggcttactgtcctcactgtgacggtcctttc
ttcaaaagcaaagatatcgcggttatcggcggtggcaactcaggtattgaagcggcgcta
gatttggccggtatcgtcaaaaacgtgactgtatttgaattcgctgatgatttaaaagcg
gaccaggtattgattaataaagccaagtcaattgataacattaatatcattacctctgct
gccaccaaagagattaaagcgacagatggtaaagtgacttcaatcgtttatgaagaccgc
acaacaggcgatatcaaagagcaggacctatctgcggtattcgttcagattggcctagtg
ccaaattctgattttgttaaaggctttgtggatgtgaaccgctttggtgagattgaaatt
gatgaagcgtgtaagaccgatcgccgtggtatttttgcagcaggtgatgtgactacggta
ccgtttaagcaaatcaacattgctatgggcgaggggtccaaagcggccttatcagctttt
gaatacctagtaatgcagtaa

DBGET integrated database retrieval system