KEGG   Pseudomonas stutzeri A1501: PST_3161Help
Entry
PST_3161          CDS       T00511                                 

Gene name
ahpF-2
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psa  Pseudomonas stutzeri A1501
Brite
KEGG Orthology (KO) [BR:psa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PST_3161 (ahpF-2)
Enzymes [BR:psa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PST_3161 (ahpF-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C K_oxygenase Glutaredoxin NAD_binding_8 Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: ABP80799
UniProt: A4VP98
LinkDB All DBs
Position
complement(3404985..3406547)
Genome map
AA seq 520 aa AA seqDB search
MLDTNLKTQLKAYLEKVTQPFEIVASLDDGEKSQEMLSLLQDIASLSDKITLKTDGDDAR
KPSFSLNRIGGSISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKALDGDYSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLKAKDTFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYEVDIMNLQRASQLIPAGDEGL
HRVQFENGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEELRADAVLQRKLNSLPNVRVLKMAQTTEVKGDGQ
KVTGLVYKDRNNDEMHEVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacaccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaagtcccaggaaatgctgagcctgctg
caggacatcgccagcctcagcgacaagatcactctgaagaccgacggcgacgatgcacgc
aagccgtcgttctcgctcaaccgcatcggcggcagcatcagcctgcgttttgccggcatc
cccatgggccacgagttcacctcgctggtgctggccctgctgcaggtcggcggtcacccg
tcgaagaccgcgccggaggtgatcgagcagatcaaggctctggatggcgactacagcttc
gaaacctacttctcgctgtcctgccagaactgtccggacgtggtccaggcgctgaacctg
atggccgtgctcaatccgaacatcaagcatgtcgccatcgacggcgcgctgttccaggac
gaggtcgaagcccgccagatcatgtccgtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaggaagagatcctcgccaagctcgacaccggttccagcgcc
cgtgatgccgagaagctcaaggccaaggacaccttcgacgtgctggtggtcggcggcggc
ccggccggcgccgcagcggcgatctacgccgcgcgcaagggcatccgcaccggtgtcgca
gccgagcgcttcggcgggcaggtgctggacaccatggccatcgaaaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagagcacgtgcgcgagtacgag
gtcgacatcatgaacctgcagcgcgccagtcagttgatcccggccggcgacgaaggcctg
caccgcgtgcagttcgagaatggcggcgagctcaaggccaagaccctgatcctcgccacc
ggcgcgcgctggcgcgaaatgaacgtgccgggcgagcaggaataccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactccggcgtggaagcggccatcgacctggccggcatcgtcgctcatgtgacc
ctgctcgagttcggcgaggagctgcgtgccgacgccgtgctgcagcgcaagctcaacagc
ctgcccaacgtccgcgtgctgaagatggcacagaccaccgaggtcaagggcgacggccag
aaggtcaccggcctggtctacaaggaccgcaacaacgacgagatgcacgaagtcgagctg
gaaggcatcttcgtgcagatcggcctgctgcccaacagcgaatggctcaagggcaccctg
gaactgtcgcgcttcggcgaaatcatcgtcgatgccaagggccagaccagcatccccggc
gtgttcgccgccggtgacgtgaccacagtaccgtacaagcagatcgtgatcgccgtcggc
gagggcgccaaggcctcgctgagcgccttcgatcacctgatccggtcttccgcgccggcc
tga

DBGET integrated database retrieval system