KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2974Help
Entry
Psyr_2974         CDS       T00246                                 

Definition
(RefSeq) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
KEGG Orthology (KO) [BR:psb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Psyr_2974
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Psyr_2974
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C Thi4 K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-GeneID: 3368494
NCBI-ProteinID: YP_236046
UniProt: Q4ZS64
LinkDB All DBs
Position
complement(3566107..3567669)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALEGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTDRKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQAFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGAAGEL
HEVKFASGASLKAKTLILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVITSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITVPLEGIFVQIGLLPNSEWLKGAIELSPRGEIVVDSRGETSVPG
IFAAGDVTVAPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctatctggagcgggttactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtcccaggaaatgcttgcactgctc
aatgatgtgatcagcgtttccaaggacgtcaccctgaatgacagcggcaccgacgcacgt
actccgtcgttctcgctgagcagccctggccacgatatcagcctgcgttttgctggtatc
cccatgggtcacgaattcacctcgctggtcctggcgctgctgcaagtcggcggctatcca
cccaaggtcagtgcggaaaccatcgaacaggttcgcgcgcttgagggcgaattccatttc
gaaacctatttctcgcagtcctgccagaactgcccggacgttgtccaggcactgaatctg
atggcagtactgaaccctggtatcaagcacgtcgctatcgacggtgcgctgttccaggac
gaagtcaccgatcgcaagatcatgtcggtaccgagcatctatctgaacggtgaattgttc
ggccagggccgcatgggcctggaagagattctggccaaaatcgacaccggtgccggtgcg
cgtcaggcggaaaaactcaacgccaagcaggctttcgatgtgctggtcgtgggcggtggc
cccgcgggctctgcggcggcggtctacgctgcccgcaaaggcatccgcaccggtgttgcc
gccgagcgtttcggtggtcaggtgctcgacaccatggccatcgagaacttcatctcggta
cagcataccgaggggccgaaactggccgtggcgcttgaagaacacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgatccctggcgcagccggcgagttg
catgaagtgaagtttgccagcggtgccagcctcaaggccaagacgttgatccttgccacc
ggcgcacgctggagggagatgaatgtgccgggtgagcagcagtaccgtaacaagggcgtg
gcttattgcccgcactgcgacggtccgttgttcaaaggcaagcgcgtcgctgtcatcggt
ggtggtaactcgggtgtcgaggctgcaatcgacctggccggtatcgtgtcccatgtgaca
ctgctggagttcgacgtgcagttgcgtgccgacgcggtgctgcagcgcaagctgcacagc
ctgccgaacgtgaccgtgatcaccagtgcgcaaaccactgaagtgacgggtgatgagcag
aaggtcaacggcctgcgctacaagaaccgcaccacaggcgaagagatcaccgtgccgctc
gaaggtatcttcgtgcagatcggtctgctgcccaacagcgaatggctcaaaggtgccatc
gagctgtcgccgcgtggcgagatcgtggtcgattctcgtggagaaacttcggtgccgggt
atcttcgctgccggtgacgtgacagtcgccccgtacaagcagatcatcatcgccctgggc
gaaggtgccaaggcctccctgagcgcctttgaccacctgatccgtacctccgcaccggct
tga

DBGET integrated database retrieval system