Pseudonocardia sp. AL041005-10: WY02_27090 Help Entry WY02_27090        CDS       T04051                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism psea  Pseudonocardia sp. AL041005-10 Pathway psea03060   Protein export psea03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:psea00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     WY02_27090  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     WY02_27090  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:psea02044]     WY02_27090 Secretion system [BR:psea02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    WY02_27090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  ALE81420 UniProt:  A0A0M5LSE6 LinkDB All DBs Position complement(5741715..5741963) Genome browser AA seq 82 aa AA seqDB search MTPPGPTQLLVVLLVVVLLFGAKKLPDLARSVGRSTRILKSELSETREDGAARSEDRALE ERPAGEPAARERVAEERTTGER NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccccacccggaccgacccagctgctcgtcgtcctgctggtcgtcgtgctgctgttc ggcgcgaagaaactgcccgacctggcccgctcggtgggccggtccacccgcatcctgaag tccgagctgagcgagacccgcgaggacggcgcggcccgctccgaggaccgggccctcgag gagcggcccgccggggagcccgcggcccgggagcgggtcgcagaggaacggaccaccggc gagcgctga

DBGET integrated database retrieval system