KEGG   Pseudomonas sp. R2A2: DM292_19140Help
Entry
DM292_19140       CDS       T05921                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psed  Pseudomonas sp. R2A2
Brite
KEGG Orthology (KO) [BR:psed00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM292_19140
Enzymes [BR:psed01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DM292_19140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase Thi4 FMO-like
Motif
Other DBs
NCBI-ProteinID: AWT12176
UniProt: A0A2U9NG14
LinkDB All DBs
Position
complement(4089084..4090646)
Genome map
AA seq 520 aa AA seqDB search
MLDSNLKTQLKAYLEKVTQPFEIVASLDDGEKSRELLSLLQDIASLSDKITLKTDGDDAR
KPSFSLNRIGGDISLRFAGIPMGHEFTSLVLALLQVGGHPSKTAPEVIEQIKALDGDYRF
ETYFSLSCQNCPDVVQALNLMAVLNPNIKHVAIDGALFQDEVEARQIMSVPSIYLNGELF
TQGRMSEEEILAKLDTGSSARDAEKLMAKGAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVKETEGPKLARALEEHVREYEVDIMNLQRASQLIPAGDDGL
HRVQFENGGELKAKTLILATGARWREMNVPGEQEYRGRGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFGEELRADAVLQRKLNSLPNVRVLKMAQTTEVKGDGQ
KVTGLVYKDRNNDEMHEVELEGIFVQIGLLPNSEWLKGTLELSRFGEIIVDAKGQTSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRSSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggattccaatctcaagacccagttgaaagcctacctggagaaggtcacccagccc
ttcgagatcgtcgcgtccctcgatgacggcgagaaatcccgggagctgctgagcctgctg
caggacatcgccagcctcagcgacaagatcaccttgaagaccgacggcgacgatgcgcgc
aagccgtcgttctcgctcaaccgcatcggcggcgacatcagcctgcgtttcgccggcatc
cccatgggccacgagttcacctcgctggtgctggccctgctgcaggtcggcggccacccg
tcgaagaccgcaccagaagtcattgagcagatcaaggcgctcgacggcgactaccgcttc
gaaacctacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatcaagcacgtggccatcgacggcgcactgttccaggac
gaggtcgaggcgcggcagatcatgtcggtgccgagcatctacctcaacggcgagctgttc
acccagggccgcatgagcgaggaagagatcctcgccaagctcgacaccggttccagcgcc
cgtgatgccgagaagctcatggccaagggcgccttcgacgtgctggtggtcggcggcggc
ccggctggcgccgcagcggccatctacgccgcgcgcaagggcatccgcaccggcgtcgcg
gccgagcgctttggcggccaggtactcgataccatggccatcgagaacttcatctcggtg
aaggaaaccgaaggcccgaaactggcccgcgcgctggaagagcacgtgcgcgagtacgag
gtcgacatcatgaacctgcagcgcgccagtcagctgatcccggccggcgacgacggcctg
caccgcgtgcagttcgagaatggcggcgagctcaaggccaagaccctgatccttgccacc
ggtgcacgctggcgcgaaatgaacgtgcccggcgagcaggagtaccgcggccgtggcgtc
gcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatcggc
ggcggcaactccggcgtggaagcggccatcgaccttgccggcatcgtcgcccacgtgacc
ctgctcgagtttggtgaggagctgcgtgccgacgccgtgctgcagcgcaagctcaacagc
ctgcccaacgtccgcgtgctgaagatggcgcagaccaccgaggtcaagggcgacggccag
aaggtcaccggcctggtctacaaggaccgcaacaatgacgagatgcacgaagtcgagctg
gaaggcatcttcgtgcagatcggcctgctgcccaacagcgagtggctcaagggcaccctg
gagctgtcgcgcttcggcgaaatcatcgtcgacgccaagggccagaccagcatccccggc
gtgttcgcagccggtgacgtgaccacagtaccgtacaagcagatcgtgatcgccgtcggc
gagggcgccaaggcctcgctgagcgccttcgatcacctgatccgcagctccgcgccggct
tga

DBGET integrated database retrieval system