KEGG   Pseudonocardia sp. EC080625-04: FRP1_03820
Entry
FRP1_03820        CDS       T04054                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K20928  2-hydroxy-2-methylpropanal dehydrogenase [EC:1.2.1.98]
Organism
psee  Pseudonocardia sp. EC080625-04
Brite
KEGG Orthology (KO) [BR:psee00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FRP1_03820
Enzymes [BR:psee01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.98  2-hydroxy-2-methylpropanal dehydrogenase
     FRP1_03820
SSDB
Motif
Pfam: Aldedh LuxC DUF1487
Other DBs
NCBI-ProteinID: ALE75987
LinkDB
Position
829464..830924
AA seq 486 aa
MFVDGEFVPAAAGATFPTVDPNTGRTIAEVPRADGTDVDRAVAAAKRVAVEWQFTDAIAR
AALLRNLAALVTEHADELARLEALDSGHYLAKAQELMGAIPLWLDYWASLADKVGGRTIE
VPGNKLSFTILEPLGVTAHIVPWNYPLLIMVRSCAPALALGNTCVVKPAEDTSLSALKFA
ELVKEAGFPDGVFNVVTGYGTEAGASLAAHPDVAGITFTGSTETGKTVAKLAADHVAQVN
LELGGKSPTVVFPDADLDDAVEAAVQGFCSHTGQVCVAGTRLFVHADVRDEFLTRLTARL
DQTQVGDGFADGTQMGPLVSQKQYDRVRSYIEIGKSEATLHYGGGRPDGVGDGGYFVEPT
VFVDVAHDARIAREEIFGPVASVHTWTTEDELVEAANDSIYGLFAVLLGSDVKRLLSTAR
RLQVGGVMINDWFGELPMTPHGGHKQSGTGREEGLEAVHGYTQVKHVSINLDDSLRAGTD
WAGAPL
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgttcgtcgacggcgagttcgtcccggcggccgccggggccacgttcccgaccgtcgac
cccaacaccggccgcaccatcgcggaggtaccgcgggccgacggaacggacgtcgaccgg
gcggtcgccgcggccaagcgggtcgccgtcgagtggcagttcaccgacgcgatcgcccgc
gccgcgctgctgcgcaacctggccgcgctcgtcaccgagcacgccgacgagctcgcccgc
ctggaggcgctcgactccgggcactacctggccaaggcccaggagctgatgggcgcgatc
ccgctgtggctcgactactgggccagcctggccgacaaggtcggcgggcggaccatcgag
gtaccgggcaacaagctgtccttcacgatcctcgagccgctcggcgtgaccgcgcacatc
gtgccgtggaactacccgctgctgatcatggtgcggtcctgcgcgcccgcgctggcgctg
ggcaacacctgcgtggtgaagccggccgaggacacgtcgttgtcggcgctcaagttcgcc
gagctggtcaaggaggcgggcttcccggacggcgtgttcaacgtcgtcaccggctacggc
accgaggccggggcctcgctggccgcgcacccggacgtcgcgggcatcaccttcaccggc
tccaccgagaccgggaagacggtcgcgaagctggccgccgaccacgtcgcgcaggtgaac
ctggagctcggcgggaagagcccgacggtcgtgttcccggacgccgacctcgacgacgcc
gtcgaggccgcggtgcaggggttctgctcgcacaccgggcaggtctgcgtcgccgggacc
cggctgttcgtgcacgccgacgtccgcgacgagttcctcacccggctcaccgcgcgcctc
gaccagacgcaggtcggcgacgggttcgccgacggcacccagatgggcccgctggtctcg
cagaagcagtacgaccgggtccgctcctacatcgagatcggcaagtccgaggcgacgctg
cactacggcggcgggcgccccgacggcgtcggcgacggcggctacttcgtcgagccgacg
gtgttcgtcgacgtcgcccacgacgcccggatcgcccgggaggagatcttcggcccggtc
gcgtcggtgcacacctggacgaccgaggacgagctggtcgaggccgccaacgacagcatc
tacggcctgttcgcggtgctgctcggctcggacgtgaagcggctgctgtccacggcgcgg
cggctgcaggtcggcggagtgatgatcaacgactggttcggggagctgccgatgaccccg
cacggcgggcacaagcagtccggcaccggccgcgaggagggcctggaggccgtccacggc
tacacccaggtcaagcacgtgagcatcaatctcgacgactcgctgcgcgcgggcaccgac
tgggccggcgcgcccctgtga

DBGET integrated database retrieval system