KEGG   Pseudonocardia sp. EC080625-04: FRP1_19600Help
Entry
FRP1_19600        CDS       T04054                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
psee  Pseudonocardia sp. EC080625-04
Pathway
psee00564  Glycerophospholipid metabolism
psee01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FRP1_19600
Enzymes [BR:psee01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     FRP1_19600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N Pyr_redox NAD_binding_8 GIDA
Motif
Other DBs
NCBI-ProteinID: ALE76499
LinkDB All DBs
Position
4241347..4243059
Genome map
AA seq 570 aa AA seqDB search
MKSVELSPEARTAALQAMGDRELDVLVVGGGVVGAGSALDAATRGLSVGLVEARDFASGT
SSRSSKLVHGGLRYLEMLDFRLVAEALAERGLLIQHLAPHLVRPVPFLYPLQHRGWERLY
AGAGVALYDTLGFLSGRSRGVPHHRHLTRRGARRVVPSLRKDALVGALQYYDAQVDDARH
TMMIARTAAAYGAHVATRARVVGLLKDAGRVVGATVQDLETGERVDVRAKQVINATGVWT
DDTQGLAGERGLFKVRASKGIHLVVPRDRIRGESGLILRTEKSVLFVIPWGRHWIIGTTD
TDWDLDKAHPAASAADIDYLLEHVNAVLEQPLTHDDVEGVYAGLRPLLSGESDSTSKLSR
EHAVATPVPGLVVVAGGKYTTYRVMAKDAVDAAVHSLDAKVPESCTEDVPLLGAEGFHAL
TNATARLATQSGLHKARIEHLLGRYGSLIQEVLGVASDDPTLTEPLAGAPDYLRAEVVYA
ASHEGARHLEDILARRTRISIETFDRGVGAAEEAARLVAPVLGWNEEQVAREVDHYRKRV
EAERESQKMPDDATADAARLGAPDVVPVSG
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggtggagctctccccggaggcccgtaccgcggcactgcaggcgatgggcgac
cgcgagctcgacgtgctcgtcgtggggggtggcgtcgtcggcgccggctccgcgctcgac
gccgcgacccgcggcctgtcggtcggcctcgtggaggcgcgcgacttcgcgtccggcacg
tccagccgctcgtccaagctcgtccacggcggtctccgctacctggagatgctggacttc
cggctggtcgccgaggcgctcgcggagcgcggcctgctcatccagcacctcgccccgcac
ctggtccgcccggtgccgttcctctacccgctgcagcaccgcggctgggagcggctctac
gccggcgccggcgtcgcgctctacgacacgctcggcttcctctcgggccggtcccgcggc
gtcccgcaccaccggcacctcacccgtcgcggtgcgcgccgggtcgtcccgtcgctgcgc
aaggacgccctcgtgggcgccctgcagtactacgacgcccaggtcgacgacgcccggcac
accatgatgatcgcccgcacggccgccgcgtacggcgcgcacgtggcgacccgcgcccgc
gtcgtcgggctgctgaaggacgccggccgtgtggtcggcgcgaccgtgcaggacctggag
accggcgagcgggtcgacgtccgcgccaagcaggtcatcaacgcgaccggcgtgtggacc
gacgacacccagggcctggccggtgagcgtggcctgttcaaggtgcgggcctcgaagggc
atccacctggtggtgccccgcgaccggatccgcggtgagtccgggctgatcctgcgcacc
gagaagtcggtgctgttcgtcatcccgtggggccggcactggatcatcggcaccaccgac
accgactgggacctcgacaaggcccacccggctgccagcgcggccgacatcgactacctg
ctcgaacacgtcaacgccgtgctggagcagccgctcacccacgacgacgtcgagggcgtc
tacgcgggcctgcgcccgctgctgtcgggcgagtcggactccacgtcgaagctgtcccgc
gagcacgcggtcgcgacgccggtgcccggcctcgtcgtcgtcgccggtgggaagtacacg
acctaccgggtgatggcgaaggacgcggtcgacgccgcggtgcacagcctggacgcgaag
gtcccggagtcgtgcaccgaggacgtgccgctgctcggcgccgagggcttccacgcgctg
accaacgccaccgcgcggctggccacgcagtcgggcctgcacaaggcccggatcgagcac
ctgctcggccgctacggctcgctgatccaggaggtgctcggcgtcgcctccgacgacccg
acgctcaccgagcccctcgccggcgcgccggactacctgcgcgccgaggtcgtctacgcc
gcgtcgcacgagggcgcccggcacctcgaggacatcctcgcccgccgcacccggatctcg
atcgagacgttcgaccgcggtgtcggtgcggccgaggaggccgcccggctcgtcgccccg
gtcctcggctggaacgaggagcaggtcgcccgcgaggtcgaccactaccgcaagcgggtg
gaggccgagcgggagagccagaagatgcccgacgacgccaccgccgacgcggcccggctc
ggcgccccggacgtcgtgccggtcagcggctga

DBGET integrated database retrieval system