KEGG   Pseudonocardia sp. EC080625-04: FRP1_21835Help
Entry
FRP1_21835        CDS       T04054                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psee  Pseudonocardia sp. EC080625-04
Pathway
psee00250  Alanine, aspartate and glutamate metabolism
psee00410  beta-Alanine metabolism
psee00640  Propanoate metabolism
psee00650  Butanoate metabolism
psee01100  Metabolic pathways
psee01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psee00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FRP1_21835
   00650 Butanoate metabolism
    FRP1_21835
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FRP1_21835
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FRP1_21835
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psee01007]
    FRP1_21835
Enzymes [BR:psee01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     FRP1_21835
Amino acid related enzymes [BR:psee01007]
 Aminotransferase (transaminase)
  Class III
   FRP1_21835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: ALE74914
LinkDB All DBs
Position
complement(4728326..4729582)
Genome map
AA seq 418 aa AA seqDB search
MAQLSPLLKQATPVQAARGEGVYLYDTDGRRHLDFTAGIGVTSTGHCHPTVVKAAQEQVG
TLIHGQYTTVMHQPLLKLVERMGEVLPEGIDSVFFTNSGSEAVEASVRLARQATGRSTIV
AFDGGFHGRTMGAAALTTSGAKIRAGIGPMMGGVAFSPFPYAYRYGWSEEDTVAFALREL
DRVLASSAPASDVAAFIVEPVLGEGGYVPTPSAFLHGLRERADKHGILLIADEVQTGYGR
TGRFWGHQHAEGFTPDVIVTAKGLASGFPLSAIAAPKAIMEKAWPGSQGGTYGGNAVACA
AALATLDVVQGEGLVENARVQGEKLVAGVRDAAQGIAAIGDVRGRGLMVGIEFVDAAGNP
DGATAAKVHAAAAAQGLLLLTCGVQGNIVRMIPPLVVTGEQIDEGLALWTKALDDALS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctgtccccgctgctgaagcaggccaccccggtccaggccgcccgcggtgag
ggcgtctacctgtacgacaccgacggccgccggcacctcgacttcaccgccggaatcggc
gtcacgtccaccgggcactgccacccgacggtcgtcaaggcggcgcaggagcaggtcggc
accctgatccacggccagtacacgaccgtcatgcaccagccgctgctgaagctggtcgag
cggatgggcgaggtcctgcccgagggcatcgactcggtcttcttcaccaactccggttcg
gaggccgtcgaggcctcggtgcggctcgcgcgccaggccaccggccgctccacgatcgtc
gccttcgacggcgggttccacggccgcacgatgggcgccgcggcgctcaccacctccggt
gcgaagatccgcgccgggatcggcccgatgatgggcggggtcgcgttctccccgttcccc
tacgcctaccgctacggctggtcggaggaggacaccgtcgcgttcgcgctgcgcgagctc
gaccgggtcctggccagctccgcgccggcgtcggacgtcgcggccttcatcgtcgagccg
gtgctcggcgagggtggctacgtcccgaccccgtccgcgttcctgcacggtctgcgggag
cgggccgacaagcacggcatcctgctgatcgccgacgaggtgcagacgggctacggccgc
accggcaggttctggggtcaccagcacgccgagggcttcacgccggacgtcatcgtcacc
gcgaaggggctcgcgtccgggttcccgctgtccgcgatcgccgcgccgaaggcgatcatg
gagaaggcctggccgggctcgcagggcggcacctacggcggcaacgccgtcgcctgcgcc
gcggccctggccaccctggacgtcgtgcagggcgagggtctcgtcgagaacgcccgggtg
cagggcgagaagctcgtcgccggggtccgggacgcggcgcaggggatcgccgcgatcggc
gacgtccgcggccgtggcctgatggtcggcatcgagttcgtcgacgccgcgggcaacccg
gacggcgccaccgcggcgaaggtccatgccgccgcagccgcgcagggtctgctcctgctg
acctgcggcgtccagggcaacatcgtccggatgatcccgccgctggtcgtcaccggcgag
cagatcgacgagggcctcgcgctctggaccaaggcgctcgacgacgcgctgtcctga

DBGET integrated database retrieval system