KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0465Help
Entry
Pse7367_0465      CDS       T02369                                 

Definition
(GenBank) catalytic domain-containing protein of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00010  Glycolysis / Gluconeogenesis
pseu00020  Citrate cycle (TCA cycle)
pseu00620  Pyruvate metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
pseu01120  Microbial metabolism in diverse environments
pseu01130  Biosynthesis of antibiotics
pseu01200  Carbon metabolism
Module
pseu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pseu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pse7367_0465
   00020 Citrate cycle (TCA cycle)
    Pse7367_0465
   00620 Pyruvate metabolism
    Pse7367_0465
Enzymes [BR:pseu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pse7367_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DciA
Motif
Other DBs
NCBI-ProteinID: AFY68775
UniProt: K9SF65
LinkDB All DBs
Position
complement(591859..593184)
Genome map
AA seq 441 aa AA seqDB search
MIHEIFMPALSSTMTEGKITSWVKSLGDKVEKGETVVIVESDKADMDVETFYEGYLGAIA
VPEGEVAPVGAAIAYVAETEAEIEAAKQKAAQSTTAPSAAPAATNNASSASSTSNNASAS
SPEAATTTTTIAAPARKKGDRIIASPRAKKLAKANNLDLGVINGTGPNGRITAADVEARL
KPSTPSASAPALPAQPASAIVATTPPAIVAVPTPAPATATVQPLSTFQNAVIRNMNWSLA
VPTYHVAYSITTTALDALYKQIKPKGVTMTALLAKAVAITLQKHPLLNASYSDQGIAYKS
DINVAVAVAMDDGGLITPVLPKADQIDIYSLSRHWKELVGKARAKQLQPDEYSTGTFTIS
NLGMFGVDSFDAILPPGTGAILAIGGSKPQPVITADGAIAIRSQMKVNITCDHRVIYGAH
AAQFLQDLAKLIETNAQSLVL
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgattcacgaaattttcatgcctgcgcttagctccaccatgaccgaaggaaagattacc
tcctgggtgaaatctctcggtgacaaagtcgaaaagggcgaaaccgtggtgattgttgag
tccgacaaggcagatatggacgtagaaactttctatgagggctatttgggcgcgatcgct
gttcctgaaggtgaggttgccccagttggtgccgcgatcgcctatgtggcagaaaccgaa
gccgagatcgaagccgccaaacaaaaagcagcccaatcaaccactgcccccagcgctgcc
cctgctgccactaataatgctagtagcgctagtagtaccagtaataatgctagcgcctcc
agccctgaagcagcgaccacaactactactattgctgcaccagcacgtaaaaaaggcgat
cggatcattgcctcccctcgcgccaagaaattagccaaagccaataatctagatctaggc
gtgattaatggcactggccccaatggtcggattacggcggcggatgtggaagcccgatta
aaaccatctacaccctctgcctctgccccggctttgcctgcccaaccagcatcagcgatc
gtggcaactactccaccggcgatcgtggctgtacctacgcctgctccggcgaccgcaact
gtccaaccgctatccacgttccagaatgcagtaatccgcaacatgaattggagtctggcg
gtgccgacttatcatgtagcctatagcattactactacggcgctggatgccctctataag
caaattaagcccaagggcgtaaccatgaccgcgctgttggctaaggcggtagcaattacc
ttacaaaagcacccgttgctcaatgccagctacagcgaccaagggatcgcctacaagagc
gacattaatgtggcggtggccgtggcgatggatgatggtggtctgattacgccagtgttg
ccaaaggcagaccagatcgatatttatagcctgtcgcgccattggaaagaactagttggc
aaagcccgcgccaagcaattgcaaccggatgaatattccactggcaccttcacgatctca
aatctgggcatgtttggcgtggattcttttgatgcaattctgccacctggtactggcgcg
atcctggcgatcggtggttccaaacctcagcccgtgattactgctgatggggcgatcgca
attcgctcgcaaatgaaagtaaacattacctgcgatcaccgcgtgatctatggtgcccat
gcggcacagttcttgcaggatttggccaagttgattgaaaccaatgcccaatctctggtg
ctataa

DBGET integrated database retrieval system