KEGG   Pimelobacter simplex: KR76_11770Help
Entry
KR76_11770        CDS       T03528                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
psim  Pimelobacter simplex
Pathway
psim00250  Alanine, aspartate and glutamate metabolism
psim00280  Valine, leucine and isoleucine degradation
psim00410  beta-Alanine metabolism
psim00640  Propanoate metabolism
psim00650  Butanoate metabolism
psim01100  Metabolic pathways
psim01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psim00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    KR76_11770
   00650 Butanoate metabolism
    KR76_11770
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KR76_11770
   00280 Valine, leucine and isoleucine degradation
    KR76_11770
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KR76_11770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psim01007]
    KR76_11770
Enzymes [BR:psim01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KR76_11770
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     KR76_11770
Amino acid related enzymes [BR:psim01007]
 Aminotransferase (transaminase)
  Class III
   KR76_11770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIY17264
UniProt: A0A0A1DIW1
LinkDB All DBs
Position
complement(2420372..2421715)
Genome map
AA seq 447 aa AA seqDB search
MSQQPTGGPSITQERRLVTAIPGPRSQELAARKAKAVASGVAVGLPVQIVAAGGGILVDA
DGNQLIDLGSGIAVTTVGNSAPRVVEAVTRQVAEFTHTCFMVTPYEGYVAVAEKLNELTP
GTHEKRSALFNSGAEAVENAVKIARSATGRQSVVVFDHAYHGRTNLTMAMTAKNMPYKKG
FGPFASEVYRAPLSYPFRDGGRDGAEAAREAIDVIEKQVGADSLAAIVIEPIQGEGGFIV
PADGFLPTLAAWCRENGVVFVADEVQTGFARTGELFACDHEGVVPDLIVTAKGIAGGLPL
AAVTGRAEIMDAAHAGGLGGTYGGNPLACAAALAVIETIEAEGLVDRARTIGKTMTERLA
ALQESDPRIGEVRGRGAMIAVELVKAGTTEPDADLTKKVAAAANAQGMVVLTCGTYGNVL
RFLPPLSMPDHLLDEALELLAEIFREN
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcagcccaccggcggccccagcatcacgcaggagcgacgcctcgtcaccgcc
atccccggcccgcgctcgcaggagctcgcggcgcgcaaggccaaggccgtcgcctcgggt
gtcgcggtcggcctgccggtccagatcgtcgccgcgggcggcgggatcctggtcgacgcc
gacggcaaccagctcatcgacctcgggtcgggcatcgcggtgaccaccgtcggcaacagc
gccccgcgcgtcgtcgaggcggtcacccgccaggtcgccgagttcacgcacacctgcttc
atggtcaccccctacgagggctacgtcgccgtggcggagaagctcaacgagctcaccccc
ggcacgcacgagaagcgctccgcgctcttcaactcgggcgccgaggccgtcgagaacgcg
gtcaagatcgcccgctccgccaccggccgccagtcggtcgtcgtcttcgaccacgcctac
cacggccggaccaacctcacgatggcgatgacggcgaagaacatgccgtacaagaagggc
ttcggcccgttcgcctccgaggtctaccgcgcgccgctgtcctaccccttccgtgacggc
ggccgcgacggcgccgaggcggctcgcgaggcgatcgacgtcatcgagaagcaggtgggc
gccgacagcctcgccgccatcgtgatcgagccgatccagggcgagggcggcttcatcgtg
cccgccgacggcttcctgccgaccctggccgcgtggtgccgcgagaacggtgtcgtcttc
gtcgccgacgaggtgcagaccggcttcgcccgcaccggcgagctgttcgcgtgcgaccac
gagggcgtcgtccccgacctgatcgtcaccgccaagggcatcgccggcggtctccccctc
gccgcggtcaccggccgcgccgagatcatggacgccgcgcacgccggcggcctcggcggc
acctacggcggcaacccgctcgcctgcgccgccgcgctcgccgtcatcgagacgatcgag
gccgagggcctggtcgaccgcgcccgcaccatcggcaagaccatgaccgagcggctcgcc
gcgctgcaggagagcgacccgcgcatcggcgaggtccgcggccgcggcgcgatgatcgcc
gtcgagctggtcaaggccggcaccaccgagccggacgccgacctgaccaagaaggtcgcc
gccgccgccaacgcccagggcatggtcgtgctgacctgcggcacctacggcaacgtgctg
cgcttcctgccgccgctgtcgatgcccgaccacctgctcgacgaggccctcgagctcctc
gccgagatcttccgggagaactga

DBGET integrated database retrieval system