KEGG   Pseudorhodoplanes sinuspersici: CAK95_05820Help
Entry
CAK95_05820       CDS       T04834                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
psin  Pseudorhodoplanes sinuspersici
Brite
KEGG Orthology (KO) [BR:psin00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CAK95_05820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LTD
Motif
Other DBs
NCBI-ProteinID: ARP98652
UniProt: A0A1W6ZMV5
LinkDB All DBs
Position
1168532..1168924
Genome map
AA seq 130 aa AA seqDB search
MYRAVTRNIEVTVSPRFLADRSAPDKGQFFWAYTIEITNNGGKTVQLKTRYWHITDGQGR
VQEVRGAGVVGEEPVIEPGKSFEYTSGVPLQTPSGFMVGRYGMVTEDGERFDIDIPAFSL
DCTHASRTIN
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgcgccgtaacacgcaatattgaagtcacggtatcgccccgttttctggccgac
cgctccgcgccggacaagggacaattcttttgggcctatacgatcgagattaccaataac
ggcggcaagaccgtgcaactgaagacgcgctactggcacatcaccgatgggcagggccgc
gtgcaggaggtccgtggtgcgggcgtcgtgggcgaagagccggtgatcgagcccggcaag
agcttcgaatataccagcggtgttcccttgcagacgccgtccggcttcatggttggccgt
tatggcatggtgaccgaggatggcgagcgtttcgatatcgacatccccgccttctccctc
gactgcacacatgcctcgcgcacgatcaattga

DBGET integrated database retrieval system