KEGG   Pseudomonas sp. TKP: U771_15625Help
Entry
U771_15625        CDS       T02969                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
psk  Pseudomonas sp. TKP
Brite
KEGG Orthology (KO) [BR:psk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    U771_15625
Enzymes [BR:psk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     U771_15625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AHC35648
LinkDB All DBs
Position
3395952..3397517
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVTSLTTLITLKTDGDDAR
KPSFSINRPGADIRLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRALKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLIPAKNAGE
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTLELEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggcgcgaaatcccaggaaatgcttgcccttttg
caggacgtaaccagcctcaccacgctgattaccctgaaaaccgatggcgatgatgcgcgc
aagccgtcgttctccatcaaccgcccgggtgccgatatcagactgcgtttcgccggtatc
cccatgggtcatgaattcacttcgttggtgttggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtgattgaacagattcgcgcccttaaaggcgagttcagcttc
gagacgtacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggctgtgctgaacccgaacatacgccacgtcgccatcgacggcgcgctgttccaggcg
gaagtcgatgagcgccagatcatggcggtgcccagtgtctacctcaacggggtgaacttc
ggtcaaggccgcatgggcctggaagaaatcctcgccaagctcgacaccagcggcatcgaa
aaagccgctgagaaaatcagcgccaaggacgcctttgatgtactcgtcgtcggtggtggc
ccggccggttcggcagccgccatctacgcagcgcgcaaaggcatccgtactggcgtggca
gccgaacgtttcggcggtcaggtgctggacaccatgtccatcgagaactttatttcggta
caggaaaccgaagggccgaaactggccagcgcgctcgaagcccatgtgcgccagtacgac
gtcgacatcatgaacctgcagcgcgccagcagcctgatcccggcgaaaaatgccggtgag
ctgcacgaaattcgctttgaaagcggtgcgacgctcaagtccaagacagtgatcctggcc
actggcgcccgctggcgcgaaatgggtgtgccgggggagcaggaatacaaggccaagggc
gtgtgtttttgcccgcactgcgatggcccgctgttcaaaggcaagcgcgtggccgtgatt
ggcggcggtaactccggcgtcgaagccgccattgacctggcaggtatcgtcagccacgtc
acgctgctcgagtttgacagcaagctgcgcgccgatgcggtgctgcaacgcaagttgtac
agcctgcccaacgttgacgtgatcaccagcgcgttgaccagtgaagtcaagggggatggc
cagaaagtcaccggcctggcatacaaggatcgcgacagcggcgagttcaagaccctcgag
ttggaaggcatctttgtgcagatcggcttgctgcccaacaccgactggctcaaaggcacc
gtggagctgacgccccgtggcgagatcattgtcgacgcccgtggcgaaacctcattgccc
ggtgtattcgctgccggtgacgtgaccacggtgccgtacaagcagattgtgatcgcggtt
ggagagggcgccaaggcttccctgagtgcgttcgatcacctgattcggacgtccgctccg
gcgtaa

DBGET integrated database retrieval system