KEGG   Paeniclostridium sordellii: RSJ16_14725Help
Entry
RSJ16_14725       CDS       T05252                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
psor  Paeniclostridium sordellii
Brite
KEGG Orthology (KO) [BR:psor00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psor01001]
    RSJ16_14725
Enzymes [BR:psor01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RSJ16_14725
Protein kinases [BR:psor01001]
 Serine/threonine kinases: Other
  Bacterial family
   RSJ16_14725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo Kinase-like Pkinase_fungal RIO1 PBP1_TM FTA2
Motif
Other DBs
NCBI-ProteinID: AUN15411
LinkDB All DBs
Position
complement(2965042..2966862)
Genome map
AA seq 606 aa AA seqDB search
MGETVLGNRYEIIKKIGDGGMAFVYEARDKLLNRTVAIKVLRPEFVDDEEFLSKFKREAE
AVASLSHPNIVNVYDVGEDGKVHYIVMELIEGQNLKDIIKNEGTLDEYTALDITKQIAKA
LGAAHKKGIIHRDIKPHNILISNEGRIVKVADFGIAKAVSSSTMTSTGSVIGSVHYFSPE
QAKGKFVGKTTDLYSLGIVLYEMIIGRVPFRGDSPISIALQHINDEIEFTQEEKVAIPQS
VRNIIKKLTSKASADRYQGADELIEDIEYIEKNIDLDFIKEYDNYATQKIDEKELNKALK
LGDTNPKIKYDEEDLEEAEEERKIPKKSKKRNKKSDNPKSKRRWKIAAVILSLILIAQII
FIGKIALGFKGNKVEQGTAPELINKTLDEAQDMAKELGVNIRVSVEEYNDKIDKNHIISQ
APNAGSAIKAGDTITVVVSKGKNQVSAPSVVGLTLSDAENSIKEKGFVLGTINYEYSDSH
DKDVVISQSPNGGSLKPGDKINVVVSRGPKPVEQKPVTPEPPKEPEQPADPNKPTDGNGN
GGGHDNTKPGDTGSENQNPEQSPGESTDGVSGTPSDSGSGTGNNGTPSGGSTGANHIQQN
TGTHQQ
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaaacagttttaggaaacagatatgagataattaaaaaaattggcgacggtggg
atggcatttgtatacgaagctagagataaacttttaaatagaactgtagctataaaggtt
ttaagaccggagtttgtagatgatgaagagtttttaagtaaatttaaaagagaagctgaa
gctgttgcaagtctttctcatcctaatatagttaatgtatatgatgttggcgaagatgga
aaagttcactatatagttatggaacttatagaaggacaaaatttaaaagatattataaaa
aatgaaggaactctagatgaatatactgcactagacataactaaacaaattgctaaagca
ttaggagcagctcataaaaaaggtattatacatagagatataaaacctcacaatatactt
atttctaatgaaggtagaattgtcaaagttgctgattttggaatagcaaaagctgtttca
agctcaactatgacaagtacgggaagtgtaattggatcagttcattatttttctccagaa
caagctaaaggaaaatttgtaggaaaaactacagatttatattctttagggatagtattg
tatgaaatgataatagggagagtaccttttagaggtgatagtcctatatctatagcgctt
caacatatcaatgatgaaatagaatttactcaagaagaaaaggtagcaatacctcaaagt
gttagaaatataataaagaaattaacttcaaaggctagtgctgatagatatcaaggtgca
gatgagcttatagaagatatagagtatatagaaaaaaatatagatttagactttatcaaa
gaatatgataattatgcaactcaaaaaatagatgaaaaggaattaaataaagcactaaaa
cttggagatacaaatccaaagattaaatatgacgaagaggatttagaagaagctgaagaa
gaaagaaagattcctaaaaaaagtaaaaaaagaaataaaaagtcagataatcctaagagt
aaaagaagatggaaaattgcagctgttatattatcattaatattaatcgctcaaataata
tttataggtaaaattgcgttaggatttaagggtaataaagttgaacaaggaacagcacca
gagcttataaataaaactttagatgaggctcaggatatggctaaagagttaggtgtaaat
ataagggtaagtgtagaagaatataatgataaaattgataagaatcatataatttctcaa
gctccaaatgcaggaagtgctataaaagctggggatactattacagttgttgtaagtaaa
gggaaaaatcaggtatcagcacctagtgtagttggacttactttatctgatgctgaaaat
tcaataaaagaaaagggatttgttttaggcactataaattatgaatatagtgactctcat
gataaagatgtagtgatatctcaatctcctaatggaggaagtttaaagccaggagataaa
ataaatgtagttgtcagcagaggtccaaagccggttgaacaaaaaccagttacaccagag
ccaccaaaggagccagaacaaccagcggatccaaataaaccaacagatggaaatggtaat
ggtggaggtcatgataacactaaacctggagatacggggtctgaaaaccaaaacccagaa
caaagcccaggagaatcaactgatggagtcagtggaacaccatcagactcagggtcagga
actggaaataatggaacaccatcaggaggaagtacaggagcaaatcatatacagcagaat
acaggaacccatcaacaataa

DBGET integrated database retrieval system