KEGG   Pseudomonas sp. Os17: POS17_4231Help
Entry
POS17_4231        CDS       T04177                                 

Gene name
mrdA_1
Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
psos  Pseudomonas sp. Os17
Pathway
psos00550  Peptidoglycan biosynthesis
psos01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:psos00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    POS17_4231 (mrdA_1)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    POS17_4231 (mrdA_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psos01011]
    POS17_4231 (mrdA_1)
Enzymes [BR:psos01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     POS17_4231 (mrdA_1)
Peptidoglycan biosynthesis and degradation proteins [BR:psos01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   POS17_4231 (mrdA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAQ75925
UniProt: A0A0D6BLX0
LinkDB All DBs
Position
complement(4770505..4772397)
Genome map
AA seq 630 aa AA seqDB search
MPEAIPIKDHEKENRLVNKRLLACAVLVVAITCALVGRMYFLQVVEFDYHSTISENNRVH
VLPITPTRGLIYDRNGVVLADNRPSFNLTITRERTTDLKGELDTVVDLLHLPPEDRTLFD
KEMKQARHPFVPVTLFYELTEEQIAVLAVNEYRLPGLDVEAQFVRHYPMGAHFAHSIGYV
GRINEKEAKTLDSVEYRGTQSIGKTGIEKFYESELHGHVGYEEVETNAQGRVMRVLRHTD
PIPGKNIVLSLDIKLQEAAEEALGDRRGSVVALDPATGEVLAMVSKPSFDPNLFVTGISF
KEYAALHDSIDRPLFNRVLRGLYAPGSTIKPEVAIAGLDTGVVTASTRVFDPGYYQLPDF
DHKYRNWNHSGDGWVDMDAAIMRSNDTYFYDLAHKLGIDRLHDYMAMFGLGEKVSLDMFE
ESPGLMPSQAWKRATRRQPWFPGETVILGIGQGYMQVTPLQLAQATALIANKGVWNRPHL
AKTIDGVAPVDEHPMPNILLKNPRDWDQVNHGMQMVMHDPRGIARAAAAGAQYRIAGKSG
TAQVVAIKQGERYDRLKTRERNRDNALFVGFAPAEHPQIVISVMIENGEAGGRVAGPVVR
QIMDAWLLDQNGHLKPQYAAPAKAPGDPHV
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaagcgattccgatcaaggaccacgaaaaagaaaaccgcctggtcaataagcgc
ctgctggcctgcgctgtgctggtggtggccatcacctgtgccctggtagggcgcatgtat
ttcctccaggtggttgagtttgactatcactccaccatctcggaaaacaaccgtgtccac
gtgctgccgatcaccccaacccgcgggttgatctatgaccgcaatggcgtggtcctggcc
gacaaccgccccagcttcaacctgaccatcacccgcgagcgcaccaccgatctcaagggc
gagctggacaccgtggtcgacctgctgcacctgccgccagaagaccgcaccctgttcgac
aaggaaatgaagcaggcccgccaccccttcgttcccgtgaccctgttctacgagctcact
gaagagcagatcgccgtattggcagtcaacgaataccgcctgccgggcctggatgtcgaa
gcccagttcgttcgccactaccccatgggcgcgcactttgcccactccatcggctacgtc
ggacggatcaacgaaaaggaagccaagaccctggattcggtggagtaccgtggcactcaa
tccatcggcaagaccggtatcgagaagttctacgagtccgaactgcacggccacgtgggc
tacgaagaagtcgaaaccaacgcccagggccgggtgatgcgcgtgctcaggcacaccgat
ccgatccccggcaagaacatcgtcctgagcctggacatcaagctccaggaagccgccgaa
gaagccctcggggatcgccgcggctccgtggtcgccctcgatccggccaccggtgaagtg
ctggccatggtcagcaagcccagcttcgaccccaacctgttcgtcaccggcatcagcttc
aaggaatacgcggcgctgcacgattccatcgaccgccccttgttcaaccgggtgctgcgc
ggcctctatgccccaggctccaccatcaagccggaagtggcgattgccggccttgatacc
ggcgtagtcaccgcatcgacccgcgtcttcgacccgggctactaccaactgccggacttc
gaccacaaataccgcaactggaaccacagcggcgatggctgggtggacatggacgccgcg
atcatgcgctccaacgacacctacttctacgacctggcgcacaagctcggcatcgaccgc
ctgcacgactacatggcgatgttcggcctcggcgaaaaagtctccctggacatgttcgaa
gaatcccccggcctgatgccgtcccaggcctggaagcgcgccactcgccgccagccctgg
ttcccgggggaaaccgtgatcctcggcatcggccagggctacatgcaggtcaccccgctg
caactggcccaggccaccgcgctgattgccaacaagggcgtgtggaaccgcccgcacctg
gccaagaccatcgacggcgtggccccggtggatgagcacccgatgcccaacatcctgctg
aagaacccccgcgactgggatcaggtcaaccacggcatgcaaatggtcatgcacgacccg
cgcggcattgcccgcgccgcagccgccggagcgcaataccgcattgccggcaagagtggc
accgcccaggtggtggcgatcaagcagggcgaacgctacgaccgcctcaagacccgcgag
cgcaaccgcgacaacgccctgttcgtcggcttcgcccccgccgaacacccgcagatcgtg
atctcggtgatgatcgagaacggcgaagccggcggccgggtcgccggccccgtggtgcga
cagatcatggacgcctggctgctggaccagaacggccacctcaagccgcaatacgccgcc
ccggccaaggctcccggtgatccccacgtctga

DBGET integrated database retrieval system