KEGG   Pseudomonas savastanoi pv. phaseolicola 1448A: PSPPH_2725Help
Entry
PSPPH_2725        CDS       T00266                                 

Definition
(GenBank) sorbitol dehydrogenase, putative
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
psp  Pseudomonas savastanoi pv. phaseolicola 1448A
Brite
KEGG Orthology (KO) [BR:psp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSPPH_2725
Enzymes [BR:psp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PSPPH_2725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AAZ35467
UniProt: Q48I66
LinkDB All DBs
Position
complement(3150559..3151617)
Genome map
AA seq 352 aa AA seqDB search
MQAVVCYGPEDYRLETVDVPTPGPDEILTKVELCGICMGDIKTYRGAPSFWGDAEQPRYV
KPPMIPGHEFVCRVVALGPGAEKRGVQIGDRVISEQIVPCWGCRFCNHGQYWMCQKHDLY
GFQNNVQGAMAQYMIFTKEGIIHKVPDSIAPDEAILIEPLACSLHAAERANVDFDDIVVV
AGAGTLGLGIIGAVRMRNPKKLIVLDMKPERAALALRMGADEVWNPAEVDVLAKIREITG
GYGCDIYIEATGHHKAVNQGLAMLRKLGRFVEFSVFNDEATVDWSIIGDRKELDVLGSHL
GPYMSPRAIDFIGNRKIDMRDVVTHKFPLAEFKEAFAVMERGDKSLKVVLQP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagtggtttgctatggcccggaagactaccggctggagaccgtcgatgtgccg
acgccaggccccgacgaaatcctcaccaaggtagagctgtgcgggatttgcatgggcgac
atcaagacctaccgcggcgctccgtcattctggggcgatgccgagcagccccgttacgtc
aaaccaccgatgattccgggccatgaatttgtctgccgggtggttgcgctcggcccaggc
gcagaaaagcgtggcgtgcagatcggcgaccgggtaatttccgagcagatcgtcccgtgc
tggggctgccgcttctgcaaccacgggcaatactggatgtgtcagaaacacgacctgtac
ggttttcagaacaacgtgcagggcgcgatggcccagtacatgatcttcaccaaagaaggc
atcatccataaagtgccggattcgatagccccggacgaagcgatcctgatcgaaccgctg
gcctgctcgttgcacgcggcagaacgagccaatgtcgatttcgacgacatcgtggtggtc
gccggtgcgggcacgctgggcctcgggatcattggcgcagtgcgtatgcgcaacccgaaa
aaactcattgtgctggacatgaaacccgagcgcgccgccctcgccttgcgcatgggcgct
gacgaggtgtggaacccggccgaggtcgatgtactggcgaagatccgtgagataaccggc
ggctacggctgcgacatctatatagaagccacagggcatcacaaggcggtcaatcagggc
ctggcaatgctgcgcaaactcgggcgttttgtggagttcagcgtgttcaacgacgaggcc
acggtggactggtcgatcattggcgaccgtaaggaactggacgtactcggctcccatctg
gggccttacatgtccccgcgtgccatcgactttattggcaatcgcaagatcgacatgcgc
gatgtcgtcacgcacaaattccccctggcggagttcaaggaggcgttcgcggtcatggag
cgtggcgacaaatcattgaaggtcgttctgcaaccttga

DBGET integrated database retrieval system