KEGG   Punctularia strigosozonata: PUNSTDRAFT_144259Help
Entry
PUNSTDRAFT_144259 CDS       T03131                                 

Definition
(RefSeq) kinase-like protein
Organism
psq  Punctularia strigosozonata
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 18881245
NCBI-ProteinID: XP_007384795
JGI: 144259
LinkDB All DBs
Position
Unknown
AA seq 475 aa AA seqDB search
MNPSRSSSLSLPALSHPADPRSLLPPQPQPPSRRGSEAMLSDGLPSPPISPGHSDNEDDS
DLDDGAIVVDAEPRYSGPERTIPAHIHEPRPASSDDSPVHRPVSVRKYGREHADADVRMD
GEDEDAPAPKPPLRYLEHEQSRLSKPGVLKLTDFEVKGTLGTGTFGRVLLVRHRGGVPGA
QNYFALKVLRKTEIVRLRQVDHVKNERYILSRVRHPFVVDLYATFQDSLNIYMLLSYVPG
GELFTHLRRAQRFTPDVARFYLATIALALKYLHSFNVVYRDLKPENLLLDARGYVRLTDF
GFAKIVDDRTWTLCGTPEYLAPEIIQSDGHGKAADWWAAGVLAYEMMVGYPPFFDETAYG
IYDKILRGRVHFPREMDPLTREFVRALLEPDKSKRLGNLNGEAQDVLDHAWFRGVDWDAL
ERREIRAPIIPHTSGVEDTRHFLHLPYPPADEIPGLVRDDDVVSLDAASCFADFA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaacccttcgcgctcctcctcgctctccctcccggctctctcccaccccgccgacccg
cgttcgctcctccccccgcaaccacaaccgccctcccggcgcggctccgaggcgatgctc
tccgacggcctcccctcgccacccatctcgcccggccacagcgacaacgaggacgactcg
gaccttgacgacggcgcgatcgtcgtcgacgcagagccacgttacagcggtccggaacgc
acgatccccgctcacatccacgagcctcgcccagcctcgtcggacgacagtcccgtgcac
cgccccgtgtccgtgcgtaaatacgggcgggagcacgcggacgcggacgtgcgcatggac
ggtgaagacgaagacgcaccggcacctaagccaccgctgcgctacctcgagcacgagcag
tcgcgcctctcgaaacccggcgtgcttaagctcaccgactttgaggtcaagggcaccttg
gggacgggcaccttcggccgcgttctcctcgtccggcaccgcggcggcgtccccggcgcg
caaaactacttcgcgctcaaggtgctccgcaaaacggagatcgtccggctccgacaggtc
gaccacgtcaagaacgagcgctacatcctctcccgcgtccgacacccgttcgtcgtcgac
ctctacgccacctttcaggacagcctgaacatctacatgctgctctcctacgtccccggc
ggtgagctcttcacccacctccggcgcgcgcagcgcttcacgcccgacgttgcccgcttc
tacctcgccaccatcgcgctcgcgctcaagtacctccactccttcaacgtcgtctaccgc
gacctcaagccggagaacctcctcctcgacgcgcgcggctacgtccgcctcaccgacttt
ggcttcgccaagatcgtcgacgaccgcacctggacgctctgcggcacccccgagtacctc
gcgccggagatcatccagtcggacgggcacggcaaggccgcggactggtgggcggcgggc
gtgctcgcgtacgagatgatggtcggctacccgcccttcttcgacgagaccgcctacggc
atctacgacaagatcctccgcggccgcgtccacttcccgcgcgagatggacccgctcacg
cgcgagttcgtccgcgcgctgctcgagccggacaagtcgaagaggttgggaaacctcaac
ggcgaggcgcaggacgtgctcgaccacgcctggttccgcggcgtcgactgggacgcgctc
gagcgccgcgagatccgcgcgccgatcatcccgcacacgtccggcgtcgaggacacgcgc
cacttcctccacctgccgtacccgcccgcggacgagataccgggcctggtccgcgacgac
gacgtcgtctccctcgacgccgcctcctgctttgccgactttgcctga

DBGET integrated database retrieval system