KEGG   Pseudomonas stutzeri DSM 4166: PSTAA_3739Help
Entry
PSTAA_3739        CDS       T01976                                 

Gene name
pilS
Definition
(GenBank) two-component sensor PilS
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
psr  Pseudomonas stutzeri DSM 4166
Pathway
psr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PSTAA_3739 (pilS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:psr01001]
    PSTAA_3739 (pilS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psr02022]
    PSTAA_3739 (pilS)
   02035 Bacterial motility proteins [BR:psr02035]
    PSTAA_3739 (pilS)
Enzymes [BR:psr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     PSTAA_3739 (pilS)
Protein kinases [BR:psr01001]
 Histidine kinases
  NtrC family
   PSTAA_3739 (pilS)
Two-component system [BR:psr02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   PSTAA_3739 (pilS)
Bacterial motility proteins [BR:psr02035]
 Pilus system
  Twitching motility proteins
   PSTAA_3739 (pilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 PAS_7 PAS PAS_9 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AEA85596
LinkDB All DBs
Position
3994041..3995633
Genome map
AA seq 530 aa AA seqDB search
MGTENLTFFGDQGRRILRLYHLYRLTIGLALVLLISSDLHNDLLQMSNPQLFQYGAWLYL
ILNIIVAVLVQSPERDLPVLSLALMDVILLSGLFYFGGGTPSGIGNLLIVAVAIANILLR
GRVGFFIAAVAATGLIYLTFYLSISRSEASSQYVQAGALGTLCFAAAFLVQGLTRRLQVS
ETLARQRAEEVANLEALNALILQRMRTGIMVLDPQERVLLANQGALQLLGQESLAGERLA
PRCPELLKALQHWRGNPTLRPPNLKATPGGPTLQPSFAALQHGNKLDTLVFLEDISQIAQ
KAQQLKLASLGRLTASIAHEIRNPLGAISHAAQLLQESEELDGPDRRLAQIIQDHSRRMN
LVIENVLQLSRRRQAEPQLLDLKYWLHRFVSEFRQGLSPQQTVHLETIGSSLQTRMDPNQ
LTQVLTNLVQNGLRYSGKEHDRAQVWLRLFRDEASDLPVVEVLDDGPGIAAEQLHNVFEP
FFTTESKGTGLGLYISRELCESNQARLDYRERAEGGSCFRIVFAHPRKLS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
gtgggcactgagaacctcaccttcttcggcgaccaggggcggcgcatccttcgcctgtat
cacctctaccgcctgaccattggcctcgcgctggtgctgctgatcagcagcgacctgcac
aacgatctgctgcagatgagcaatccgcagctgttccagtacggcgcctggctctatctg
atcctcaacatcatcgtcgcggtgctggtgcagagccccgagcgcgacctgccagtgctc
agcctggcgctgatggacgtgatcctgctgtcgggattgttctattttggcggaggaacg
ccgagcggcatcggtaacctgctgatcgtcgccgtcgccatcgccaatattctcctgcgg
gggcgggtcggtttcttcatcgccgcggtcgctgccaccggcctgatctacctgaccttc
tacctgagcatcagccgttccgaagccagcagccagtacgtccaggccggtgcgctcggc
acgctgtgcttcgccgcagcctttctcgtccagggactgactcggcgcctgcaggtcagc
gagactctggcccgccagcgcgccgaggaggtcgccaacctcgaggccctcaacgcgctg
atcctgcagcgcatgcgcaccggcatcatggtgttggacccgcaggagcgcgtgctcctg
gccaaccagggggcgctgcagttgctcggccaggaatcgctggccggcgagcgcctcgcg
ccgcgctgcccggagctgctcaaggcactgcagcactggcgtggcaatcccacactgcgc
ccgccgaacctcaaggccacccccggcggaccgacgctgcagccgagtttcgccgccctg
cagcacggcaacaagctcgacactctggtgttcctcgaggacatctcgcagatcgcccag
aaggcccagcaactcaagctcgcctccctcggacgactcacagccagcattgcccatgaa
atccgcaatccgctgggcgccatcagccatgctgctcagctgctacaggaatccgaagag
ctggacggcccggatcggcgactggcgcagatcatccaggaccactcgcggcggatgaat
ctggtcatcgagaacgtgctgcagctttcccggcgccgccaggcggagccccagctgctg
gatctcaaatactggctgcatcgcttcgtcagcgagttccgccaggggctcagcccgcag
cagacggttcacctggaaaccatcggcagctcgctgcagacgcgcatggaccccaaccag
ctgacccaggtgctcaccaacctggtgcagaacggcctgcgctacagcggcaaggagcac
gatcgcgctcaggtctggcttcgcctgtttcgcgacgaagccagcgatctgccggtcgtt
gaggtcctcgacgatggacccggcatcgccgccgagcagttgcacaacgttttcgaaccc
ttcttcaccaccgagagcaaaggcaccgggctcgggctgtacatctcccgcgagctgtgc
gaaagcaaccaggcacgcctggactaccgcgagcgcgccgaaggcggcagctgcttccgc
atcgtcttcgcgcacccgcgcaagctgagctag

DBGET integrated database retrieval system