KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102446334
Entry
102446334         CDS       T02980                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00220  Arginine biosynthesis
pss00330  Arginine and proline metabolism
pss01100  Metabolic pathways
pss04020  Calcium signaling pathway
pss04146  Peroxisome
pss04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    102446334 (NOS2)
   00330 Arginine and proline metabolism
    102446334 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102446334 (NOS2)
   04020 Calcium signaling pathway
    102446334 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102446334 (NOS2)
Enzymes [BR:pss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     102446334 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 102446334
NCBI-ProteinID: XP_025035085
Ensembl: ENSPSIG00000014689
LinkDB
Position
Unknown
AA seq 1152 aa
MMCPWQFLFKPQTGRNESHKEKDINNNVEKAAMEVHSFVKNKATMLNDLNKIQNEMLHAI
TAEEKPPQNKVQPMSQISGCPRHLKIKNWENGTSFHDTLHQSAKEVLNCRTKACQSALMN
PKGLVRGPRDTPVPPEEILPQAIEFINQYYNSLKEPQPEEHQGRMQSVTEEIETTGTYQL
TKDELIFATKQAWRNAPRCIGRIQWSNLQVFDARDCTTAKEMFEHICRHLEYSSNNGNIR
SAITVFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSILGDPASMELTQLCIDLGWKPKYGR
FDVLPLILQANGQDPEIFDLPPELVLEVSMEHPKYDWFKELNLKWYTLPAVANMLLEVGG
LEFTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDQAVIEINIA
VLHSFQKQNVTIMDHHSAAESFMKYMQNEYRLRGGCPADWVWLVPPISGSITPVFHQEML
NYVLTPFYYYQVDAWKTHVWHDEKRRPKKREIKFSVLAKAVFFASALMQKKMAARTKVTV
IYATETGKSETLANNLCALFNCAFSTQVLCMDEYKLSDLEKEALLLVVTSTFGNGDSPGN
GKKLKNALLIKKQLQKTFRYAVFGLGSTMYPEFCAFAHAIDQKLAQLGASQLTPTGEGDE
LNGQEEAFRSWAVNAFKAACEVFDIRGKNSIQLPKVYTANETWNPKNYRIAHDSQPLDLT
KALADTHAKDVIPMKLKFRQNLQSTKSSRVTLQLKLSCETNQEVRYLPGEHVGIFPGNRP
ELVSGIIERVTDAPPTDQIIRLETYNDGGYWTSDKKIPPSTLSQALTYFLDVATPPSQQL
LKKLSQLATEEGDKNRLDVLCHSSEEYNKWKFFNSPTILEVLKEFPSTQVSTSFLLTQLP
LLKPRYYSISSSQDMTPREIHLTVAVVSYRTKDGQGPLHHGVCSTWLNTIDLQETVPCFV
RSASGFQLPKDPSTPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGSGMTLLFGCRRPDM
DHLYREETQDMKRKGVLKEAYTAYSQQPGQAKVYVQDILQSKLEEEVHQVLHEEEGHLYI
CGDVRMARDVAQTLKEMFAKKLKLTEEQAEDYMFQLKSQKRYHEDIFGAMVPHASKRDAR
ALKPNSPRTTQQ
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgatgtgcccttggcagttcctattcaagccccaaaccggtaggaacgagtcccacaaa
gagaaggatataaacaataatgtggaaaaagcagccatggaagttcacagcttcgtgaaa
aacaaagccaccatgctaaatgatctgaacaagatacagaatgagatgctgcatgccata
actgcagaagagaaacctccgcaaaacaaggtccaacccatgagccaaatatcaggatgc
ccgaggcatttaaaaatcaaaaactgggaaaatgggaccagcttccatgacacattgcac
cagtcggcaaaggaggttctcaactgcaggaccaaggcctgccaaagcgccctcatgaac
cccaaaggcttggtgagaggccccagagacacaccagtcccgccggaagagattttacct
caggcaattgaattcatcaaccaatactacaattcactgaaagagccgcagccagaagaa
caccaggggagaatgcagtcggtaaccgaagagatagaaacaaccggcacctaccagctg
acgaaagatgaactcatctttgcaaccaaacaggcctggagaaatgctccgagatgcatc
gggagaatacaatggtccaacctacaggtgtttgatgcacgggactgtacgaccgccaag
gaaatgtttgaacatatctgtcgtcatcttgaatactcctccaacaatggaaacatcaga
tcggccatcactgtctttccacagaggactgatgggaaacatgatttccgtgtatggaac
agccagctcatccgatatgctgggtaccaaatgccagatggctccatcttgggagatcca
gctagtatggagctgacacagttatgcattgatcttgggtggaagcccaagtatggccgc
tttgatgtacttccactgatcctccaagcaaacggccaagacccggaaatatttgatctg
ccgccagaacttgtccttgaagtgtcaatggaacatccaaagtatgactggtttaaggaa
ctcaacttgaagtggtacaccctgcctgctgttgccaatatgctcctagaagtggggggc
ctggagtttacagcttgcccatttaatggctggtacatggggacggagataggtgtgcga
gacttctgtgacgtgcaacgctacaatatcctgaaggaagtagggagaaggatgggtctg
gaaaccaacaaactttcctcattatggaaagatcaagcagtgatagagattaatattgct
gtgcttcatagtttccaaaaacaaaacgtcaccatcatggatcaccactccgcggccgag
tccttcatgaaatacatgcagaacgagtaccgccttcgaggagggtgcccagctgactgg
gtctggctggtgcccccgatatcaggcagcattactccagtgtttcaccaggagatgctg
aactacgtcctcacaccattctactattaccaggtggatgcttggaaaacacacgtctgg
catgatgagaaacgcaggcctaagaagagggagatcaaatttagcgttttggcaaaggcc
gtattctttgcctctgcattgatgcagaaaaaaatggcagcccggaccaaggtgacggtg
atctatgcaacggagactgggaaatctgaaacactggccaataacttgtgtgccttgttc
aactgcgccttcagcacccaggtcctctgcatggacgaatacaagctcagcgacctggag
aaagaagccctccttctagtggtgaccagcacttttggaaacggcgactcaccaggcaat
ggcaagaaattgaagaatgccctgctcattaagaaacagctgcagaaaacattcagatat
gctgtcttcggcctggggtccaccatgtacccggagttctgtgccttcgctcatgccatc
gaccaaaaactcgcacaattaggcgcctctcagcttacccctacaggtgaaggggatgaa
ctcaatgggcaggaagaagcttttcgcagctgggcagttaatgcattcaaggctgcctgt
gaggtttttgacatacgtggaaaaaacagtattcagctacccaaggtgtacactgcaaat
gaaacctggaatcccaagaattacaggatagcacatgactcccagcctttggacttaact
aaagcactagcagacacacatgcaaaagatgtgattcccatgaagctcaaattcaggcag
aatctgcaaagtacaaaatccagccgcgttaccctgcagcttaagctttcctgtgagact
aatcaggaagttcgctatttgccgggagaacatgttgggattttcccaggcaaccggcca
gaattagtcagtggcatcattgagcgtgttacggatgcaccaccgaccgatcaaatcatc
aggctggaaacctataacgatggtggctactggacaagtgacaagaaaatcccaccctcc
acactttcccaagccctgacgtacttccttgatgttgctactccaccctcccaacagctg
ctaaaaaaactctctcagctggcaacagaggaaggagacaaaaacagactggatgtcttg
tgccatagctcagaggagtacaacaagtggaagtttttcaacagccccactattctggag
gtactgaaagaatttccttccacccaagtctccacgtcttttttgctgactcagctgcct
ttgctgaaaccccggtactattccattagttcctcccaggacatgacacccagagagatc
catctgactgttgcagtggtcagctaccggacaaaggatggtcaaggtcctttgcaccat
ggcgtttgcagcacttggctgaatacaatagatctccaggagaccgtcccatgctttgtg
cgcagcgcgagcggattccagcttcccaaagacccctccacaccctgcattctgattggc
ccggggacaggaattgctccattcagaagcttctggcagcagcgtctctatgacttagaa
aagaaaggaattaaaggcagtggcatgacattgctgtttggctgccggcggccagacatg
gaccatctctacagagaagaaactcaagacatgaaaagaaaaggcgtgttgaaagaggcc
tacacagcatactcccagcaacccggccaggctaaagtctatgttcaagacattcttcaa
agcaagttggaggaagaagtgcaccaagtcttgcatgaagaggaagggcatttgtacatc
tgtggggacgtgcgcatggcccgggacgtcgcccagaccttgaaggagatgttcgcgaag
aaactgaaattgacagaggaacaggctgaagactacatgttccagctgaagagccaaaag
cgataccacgaggacatatttggggctatggttccacatgccagcaagagagatgcaaga
gctttgaaacccaatagtccaagaaccactcaacagtga

DBGET integrated database retrieval system