KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102447882Help
Entry
102447882         CDS       T02980                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Pathway
pss00480  Glutathione metabolism
pss00980  Metabolism of xenobiotics by cytochrome P450
pss00982  Drug metabolism - cytochrome P450
pss00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:pss00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102447882 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102447882 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102447882 (GSTO1)
   00983 Drug metabolism - other enzymes
    102447882 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pss02000]
    102447882 (GSTO1)
Enzymes [BR:pss01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102447882 (GSTO1)
Transporters [BR:pss02000]
 Other Transporters
  Pores ion channels [TC:1]
   102447882 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 102447882
NCBI-ProteinID: XP_006135447
Ensembl: ENSPSIG00000010874
UniProt: K7FVN7
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MAGESARSLGKGSPAPGPVPEGLIRLYSMRFCPFAERTRLVLKAKGIKHETVNVNLKNKP
DWLFEKNPFGLVPILETSKGQLIYESPVTCEYLDEAYPGKKLLPADPYERACQRMLLERF
SKLSPLAFKYLLAVKSGEDSSALKAEFIEKIGEFEQILAGRKTLFFGGDSVSMIDYMIWP
WFERLEFFQLPDGLQHAPKLRRWVEAMKNDPAVKATVTDSQTLQGFFELYVKNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggccggggagagcgcgcggagcttggggaaaggaagccctgctccaggccctgtccca
gagggtttaatccgcctctacagcatgcgcttctgtccctttgcagagagaacgcgtctt
gtcttgaaggccaaaggaattaagcatgaaacagtcaacgtcaacctgaaaaacaaaccc
gactggctctttgagaagaatccctttggcttggtgcctattctggagaccagcaagggt
cagctgatctatgagtctccagtcacatgcgagtatttggacgaagcctatcccgggaag
aagctgctccctgctgacccttatgagcgagcgtgtcaaaggatgctcttggaaagattc
tccaagttgtcacctctagccttcaaatatctccttgccgttaaaagtggggaggacagc
tcagcgttgaaagcagagttcattgagaagattggcgaatttgagcagattttagccggt
cgcaagacactgttctttggtggggactctgtgtccatgattgactacatgatctggcct
tggtttgaacgcctggaattcttccagttgcctgatggtctgcagcatgcccccaagctc
aggcgctgggtggaagccatgaagaacgatcctgccgtcaaggctacggtgactgactct
caaacgctgcaaggcttttttgagctgtatgtcaagaacagtccggaggcgtgcgactat
gggctgtga

DBGET integrated database retrieval system