KEGG   Pseudomonas stutzeri 28a24: CH92_09180Help
Entry
CH92_09180        CDS       T03390                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pstt  Pseudomonas stutzeri 28a24
Pathway
pstt00020  Citrate cycle (TCA cycle)
pstt00480  Glutathione metabolism
pstt01100  Metabolic pathways
pstt01110  Biosynthesis of secondary metabolites
pstt01120  Microbial metabolism in diverse environments
pstt01130  Biosynthesis of antibiotics
pstt01200  Carbon metabolism
pstt01210  2-Oxocarboxylic acid metabolism
pstt01230  Biosynthesis of amino acids
Module
pstt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pstt_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pstt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CH92_09180
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CH92_09180
Enzymes [BR:pstt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     CH92_09180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH SLT_L
Motif
Other DBs
NCBI-ProteinID: AHL75280
UniProt: W8QXD1
LinkDB All DBs
Position
complement(1928959..1931184)
Genome map
AA seq 741 aa AA seqDB search
MSTRSKIIYTFTDEAPALATYSLLPIVEAFAASAGIAVETRDISLAGRILASFADQLDAD
KVVADDLAKLAELTNQPDANIVKLPNISASVPQLKAAIAELQALGYNIPNFPEDPQTEAE
KDARARYSKVLGSAVNPVLREGNSDRRAPAAVKAFARKHPHSMGKWSKASQSHADYMRGG
DFFSSEQSITMDRAGDVRIEFVGKDGQVEVKKTVSLQNGEVLDGMFMSCQKLRAFFEDTL
QDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKYGELFKELGVNPNNGLSSV
YDKIKSLPDSQQEEILHDIHACYAGRPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRSS
GQMWGKDGKLKDTKAVMPESTYARIYQEMINFCKTNGAFDPTTMGSVPNVGLMAQKAEEY
GSHDKTFEMTADGTMRVVLGDGTVLMQHAVEKGDIWRACQTKDAPIRDWVKLAVTRARQS
DTPAIFWLDPERAHDRELQKKVEAYLQEHDLTGLDIRMMGYNEAIRVSMERLIRGQDTIS
VTGNVLRDYLTDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLIEENHLR
WDSLGEFLALAVSLEETGIKTDNLKAKLLGKALDAATGKLLDNNKSPSRRTGELDNRGSH
FYLALYWAQELAAQTEDSELQAHFAPLAKQLSENEQAIIAELAAVQGEPVEIGGYYRTNS
DLTSQVMRPSATFNAALAALG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccgctcgaagattatctataccttcaccgacgaagccccggcgttggccacc
tattcgcttctgcctattgtagaagcctttgccgcctctgccggtattgccgtcgaaaca
cgtgacatctctcttgcagggcgcattcttgcaagctttgccgaccagctggatgcggac
aaggtagtcgctgatgacctcgccaagctcgccgagctgaccaatcagcccgatgccaac
atcgtcaagcttccgaacatcagcgcttccgttcctcagctcaaagccgccattgctgaa
ttgcaggcgctcggctacaacattcccaacttcccggaagatccgcagaccgaagccgag
aaagacgcgcgtgcgcgctacagcaaggtattgggcagcgccgtgaacccggtcttgcgc
gaaggcaattccgatcgccgcgcacctgcagcggttaaggccttcgcccgcaagcatccg
cattcgatgggcaagtggagcaaggcctcgcaatcccatgccgactacatgcgcggcggc
gacttcttctccagcgagcaatccatcacgatggatagagctggcgacgtgcgtatcgag
ttcgtcggcaaagacggtcaggtcgaagtgaagaagacagtttcgctgcagaacggcgaa
gtgcttgacggcatgttcatgagctgccagaagctgcgggcattcttcgaagacaccctg
caggactgcaaggaaaccggcgtgatgtggtccctgcacgtgaaggccacgatgatgaag
atctcccacccgatcgtcttcggccatgccgtcagcgtctactacaaggacgtgttcgat
aaatacggcgagctgttcaaggaactgggcgtcaaccctaacaacggcttgagtagcgtc
tacgacaagatcaagtcattgcccgattcccaacaggaagagatccttcacgatatccac
gcgtgctacgccggccgcccggaaatggcgatggtcgactcggtcaagggcatcactaac
ctgcacattccaagcgacgtgatcgtcgacgcttccatgccggcaatgattcgcagctcg
ggtcaaatgtggggcaaggatggcaagctcaaggacaccaaggcggtgatgccggaaagc
acctatgcccgcatctaccaggagatgatcaacttctgcaaaaccaacggcgctttcgac
ccgaccaccatgggcagcgtaccgaacgtcggcctgatggcacagaaggccgaagagtac
ggctcacacgacaagacgttcgagatgactgccgacggcactatgcgtgtcgtgctgggc
gacggcaccgtgctgatgcagcatgcagtggaaaaaggcgacatctggcgtgcctgtcag
accaaggacgccccgattcgtgactgggtcaagctggctgttacccgtgctcgtcaatcg
gacacgccggccatcttctggctagaccccgagcgcgcccacgaccgcgagcttcagaaa
aaggtcgaagcttacttgcaagaacacgacctaaccggtctggatatccgcatgatgggc
tacaacgaagccatccgtgtcagcatggaacgcctgatccgcggccaagacaccatctcg
gtgacaggcaacgtgttgcgcgactacctgaccgacctgttcccgatcatggaactgggc
acgtcggcgaagatgttgtcgatcgtcccgctgatggccggcggcggcatgtacgaaacc
ggtgccggcggttcggcccccaagcacgtgcaacaactgatcgaagaaaaccacctgcgc
tgggattcgctcggtgagttcctggcacttgctgtttcgctcgaagaaaccggtatcaag
acagacaacttgaaggccaagctgctaggcaaggcattggatgctgctaccggaaaactc
ctcgacaacaacaaatcgccgtcgcgccgtaccggcgagctggacaatcgtggcagccac
ttttacctggcactgtactgggctcaggagttggcagcacagaccgaagactcggaacta
caggctcacttcgcaccgctggccaaacagctgagcgaaaacgagcaagccatcattgcc
gaactggcagcggtccaaggcgagccggtagaaatcggtggctattaccgtacaaactcg
gatctgaccagccaggtcatgcgccctagcgcgaccttcaatgccgcgctcgccgcgctg
ggctga

DBGET integrated database retrieval system