KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22635
Entry
UIB01_22635       CDS       T03366                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00624  Polycyclic aromatic hydrocarbon degradation
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    UIB01_22635
   00624 Polycyclic aromatic hydrocarbon degradation
    UIB01_22635
Enzymes [BR:pstu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     UIB01_22635
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     UIB01_22635
SSDB
Motif
Pfam: adh_short_C2 adh_short NmrA NAD_binding_10 Epimerase KR YjeF_N DUF608
Other DBs
NCBI-ProteinID: AHY45196
UniProt: Q9ZI71
LinkDB
Position
pLIB119:54460..55239
AA seq 259 aa
MSNQQVVSITGAGSGIGLALVRSFKSAGYCVSALVQNEEQKASLCNEFKDALEIVVGDVR
DHATNEKLIKQTTDRFGHLDCFIANAGIWDYMLGIEEPWEKISSSFDEIFNINVKSYFSG
IRAALQELKKTSGSVVMTASVSSHAVGAGGSCYIASKHAVLGMMKALAYELAPHIRVNAV
APGGTVTSLCGPASAGFDKTHMENMPGIEDMIKGLTPLGFAAKAEDVVAPYLLLASRDQG
KFITGTVINIDGGMALGRK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgagcaatcaacaagtcgtttcgataaccggtgctggctcaggaattggtctcgcactg
gttcgatcctttaagtccgccggttattgcgtatccgctctcgtacaaaacgaggagcaa
aaggcgagcctttgcaatgagttcaaggacgcactcgagatcgtcgtgggcgatgtccgg
gaccacgcaacaaatgagaagctgataaagcaaacaaccgatagattcggccatctcgat
tgtttcattgcaaatgccggtatttgggattacatgcttggcatcgaagagccttgggag
aaaatatcgagcagttttgatgagatattcaacatcaatgtcaagagctatttcagcggt
atcagggccgccctgcaggaactgaaaaagactagcggatcagtggtgatgaccgcttca
gtgtcgtcccatgcggtcggtgctggtggttcttgctacatcgccagcaagcatgcggtc
ctgggcatgatgaaagctttggcttacgaattggctccccacattcgcgtcaacgccgta
gcaccgggcggcactgtgacgtctctgtgcggtcccgcaagcgccggcttcgacaaaact
cacatggaaaacatgcccggtatcgaggacatgatcaagggtctaacgcctcttggattt
gcagccaaggccgaagacgtagtggcaccctatttgttgttggcgtcgcgagatcaaggg
aaattcattaccgggactgtcattaatatagatggagggatggcgctcggtcgcaagtag

DBGET integrated database retrieval system