KEGG   Paenibacillus terrae: HPL003_02550Help
Entry
HPL003_02550      CDS       T01668                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pta  Paenibacillus terrae
Pathway
pta00970  Aminoacyl-tRNA biosynthesis
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_02550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pta03029]
    HPL003_02550
Enzymes [BR:pta01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HPL003_02550
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HPL003_02550
Mitochondrial biogenesis [BR:pta03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HPL003_02550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AET57290
UniProt: G7W1A9
LinkDB All DBs
Position
complement(511516..512961)
Genome map
AA seq 481 aa AA seqDB search
MTTTTSKYETVIGLEVHVELHTKSKIFCGCSTSFGAPPNSHTCPICLGHPGVLPVLNRQA
VDYAMKAAMALNCTIADVSKFDRKNYFYPDSPKAYQISQYDQPIGEHGWIDIEVNGETKR
IGITRLHLEEDAGKLTHVDGGYASLVDFNRVGTPLVEIVSEPEISSPEEAKAYLEKIRAI
MQYCDVSDVKMEEGSLRCDANISLRPHGQQELGTKAELKNMNSFRGVQRGLEYEQFRQEQ
TLEEGGTIVQETRRWDEAQGKTLSMRGKEQAHDYRYFPDPDLVTLHIDAEWKERIRALIP
ELPDQRKVRYTSEYGLPEYDAQVITSSKPLADLFEDSLQYTKDAKAVSNWIMGDLLGYLN
SVGVELSQVKLTGRGLGEMIGLLEKGTINSKIAKTVFKEMLESDKLPQQIVEEKGLVQIS
DEGAIMTIVEQVVAANPQSVEDYKAGKQKAIGFLVGQVMKESKGKANPGLANKLLTEVLN
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgactactactacatccaaatatgagacggtcatcggactggaagtccatgtagaactg
catacgaagtctaaaatattttgcggatgctcgacatccttcggagcaccgccaaactcg
cacacatgtcccatttgtcttggacatccgggggtactgccggtattaaaccgtcaggcc
gttgattatgcgatgaaagcggcgatggcacttaattgcacgattgctgatgtgagcaag
tttgaccgcaaaaactatttttaccccgattcgcccaaggcttaccaaatctcgcaatac
gatcagccgatcggcgagcatggctggattgatattgaagtgaacggtgagacaaagcgt
attggtattacccgattgcatctggaagaggacgcaggcaaattaacacatgttgatggt
ggctatgcgtctttggttgattttaaccgtgtcggtacaccgttggtcgagatcgtttcg
gaaccggaaatatcttcaccggaagaagccaaggcttacttggaaaagatacgtgctatt
atgcagtattgtgacgtatccgatgtgaagatggaggaaggctcgcttcgctgcgatgcg
aacatcagccttcgtccgcatggacaacaagagctaggtactaaagctgagctaaaaaac
atgaactccttccgtggcgtacagcgcggattggaatatgagcagttccgccaggagcag
acgctggaggaaggcggaacgattgtacaggagactcgccgttgggatgaggcccaaggt
aaaactctgtccatgcgcggtaaggaacaggcgcatgactatcgttattttccagacccg
gatctcgttacgctgcatattgatgcagaatggaaagaacgcatccgtgctttgattcct
gaactgcctgaccagcgtaaagtacgctacacctcggaatatggattgcctgagtatgat
gcacaggtaattacgtcttccaagccactcgccgatttgttcgaggatagtcttcaatac
acgaaggatgccaaagcagtgtccaactggattatgggggatttgctcggctatttaaac
agcgtcggtgtggaactgtcacaggttaaactgacaggtcggggcttgggtgaaatgatc
gggctgctggagaagggaacgatcaatagtaaaatcgctaaaacggtcttcaaggaaatg
ctggagagtgataaactgccgcagcaaattgttgaagaaaaagggcttgtgcaaatcagc
gacgagggtgcgatcatgacgatcgtcgagcaggttgtagcggctaacccgcaatcggtt
gaggattacaaagctggcaagcagaaggccatcggattcctggttggtcaagtgatgaag
gagagcaagggcaaagcaaatcccggcctcgccaataagctgctgacggaagtgttaaac
cgctaa

DBGET integrated database retrieval system