KEGG   Paenibacillus terrae: HPL003_04975Help
Entry
HPL003_04975      CDS       T01668                                 

Definition
(GenBank) glutaminyl-tRNA synthetase
  KO
K01886  glutaminyl-tRNA synthetase [EC:6.1.1.18]
Organism
pta  Paenibacillus terrae
Pathway
pta00970  Aminoacyl-tRNA biosynthesis
pta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pta00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HPL003_04975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pta01007]
    HPL003_04975
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pta03016]
    HPL003_04975
Enzymes [BR:pta01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.18  glutamine---tRNA ligase
     HPL003_04975
Amino acid related enzymes [BR:pta01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   HPL003_04975
Transfer RNA biogenesis [BR:pta03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    HPL003_04975
 Prokaryotic type
   Other AARSs
    HPL003_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c tRNA-synt_1c_C
Motif
Other DBs
NCBI-ProteinID: AET57762
UniProt: G7VWU3
LinkDB All DBs
Position
complement(1048755..1050434)
Genome map
AA seq 559 aa AA seqDB search
MEKPITPPNFIKSVIEEDLRTGKVKEVVTRFPPEPNGYLHIGHAKAIWINFSLGDEFGGR
TNLRFDDTNPAKEDTEYVNSIQEDVKWLGYEWEEKHFASNYFDEMYKRAVLLIQKGKAYV
DDQSADQIRETRGTLTEPGQNSPYRDRSVEENFKLFEEMRAGKYQNGEKVLRAKIDMASP
NINLRDPVIYRISHTEHHNTGDKWCIYPMYSYAHPLEDAIEGVTHSLCSLEFEDQRPLYD
WVVAECEMEKVPHQYEFGRLNLAQTVTSKRKLKLLVDEKHVDGWDDPRMPTISGLRRRGY
TPEAIRSFVYETGISKAYGVIDLQVLEHFAREDLKLQAPRTMAVIDPLKVVITNYPEGQV
EMLEAENNTENPELGTRQIPFSREIYIEREDFMENPPSKYFRLFPGNEVRLKHAYFIKCN
DVIKDADGHVTEIHCTYDIETKSGSGFTGRKVKGTIHWVEATQAVPAEFRLYEPLINAED
PEAIEEDATEKTFLDQLNPNSLEIAHGFVEPNMKEAQSQDKFQFFRHGYFSVDPKLSKPG
EPVFNRVVSLKSSFQLPKQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
gtggagaagccgatcactccccccaattttattaagagtgtcattgaagaggatttacgt
acaggtaaggtaaaggaagttgttacacgctttccaccggagccgaacggatatttgcac
attggacatgccaaagccatctggatcaatttctcgttgggagatgaatttggaggacgc
accaacctgcgttttgacgatacgaatccagcgaaggaagacacggaatacgtaaactcc
attcaggaggacgtgaagtggctcggatatgaatgggaggaaaaacattttgcctccaac
tattttgacgaaatgtacaaacgtgctgttctactgatccaaaagggtaaagcctacgtg
gacgatcaaagcgcggatcaaatccgcgaaactcgtggcacactgaccgaaccggggcaa
aacagtccttaccgcgaccgtagcgtggaggaaaatttcaagctgttcgaagaaatgcgt
gcagggaaataccaaaacggtgaaaaggtgctgcgtgccaaaattgatatggcttcgccg
aacattaatttgcgtgatccggtgatttaccgtatttcgcataccgagcatcacaacacg
ggtgacaaatggtgcatttatccgatgtattcctacgctcatccgctggaggatgccatc
gagggtgtaacgcattcgctttgttcgctggagtttgaggatcagcgtccgctgtacgat
tgggttgtagccgaatgtgagatggaaaaggtaccgcaccaatacgaatttggacggctg
aacctggctcaaaccgtaaccagcaagcgtaagctcaagcttctggtagatgagaagcat
gtagacggctgggatgatccgcgtatgccaacgatttccggtttgcgccgtcgtggctat
acgccggaagctatccgcagctttgtatatgagacgggcatttccaaagcctacggcgtg
atcgacttgcaagtgctggagcattttgcacgtgaggacttgaagctacaagcgcctcgt
acgatggcggtcattgatccgttgaaggtggttattacgaactatcctgagggtcaggtt
gaaatgctggaagcggaaaacaacacggaaaatccggagctgggcacacgccaaattccg
ttttcgcgtgagatttatatcgagcgtgaggatttcatggagaatccgccgagcaaatac
ttccgcctgttccctggcaatgaagtacgcctcaagcatgcatatttcatcaaatgtaac
gatgtcattaaagatgcggatggtcatgtaacggaaatccactgtacctatgatatagaa
accaagagcggatccggctttaccggacgtaaagtcaaaggcacaatccattgggtggag
gctactcaggccgttcctgctgaattccgcctgtatgagcctttgattaacgcagaagat
ccggaagcgattgaagaggatgcaacggaaaaaaccttcctcgaccaattgaatccaaac
tctctggaaattgctcacggctttgtcgagccgaatatgaaggaagcacaatcgcaggac
aagttccaatttttccgtcatggttattttagtgtcgatccgaagctttccaagccgggt
gagcctgtattcaaccgtgtggtatcactgaaaagctctttccaattgcctaagcaatag

DBGET integrated database retrieval system