KEGG   Panthera tigris altaica (Amur tiger): 102949369Help
Entry
102949369         CDS       T02988                                 

Gene name
CIITA
Definition
(RefSeq) class II major histocompatibility complex transactivator
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04612  Antigen processing and presentation
ptg05145  Toxoplasmosis
ptg05152  Tuberculosis
ptg05164  Influenza A
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102949369 (CIITA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102949369 (CIITA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102949369 (CIITA)
  09172 Infectious disease: viral
   05164 Influenza A
    102949369 (CIITA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102949369 (CIITA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptg01001]
    102949369 (CIITA)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ptg04054]
    102949369 (CIITA)
Enzymes [BR:ptg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102949369 (CIITA)
Protein kinases [BR:ptg01001]
 Serine/threonine kinases: Other
  TAF1 family
   102949369 (CIITA)
Pattern recognition receptors [BR:ptg04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   102949369 (CIITA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_4 LRR_8 LRR_9 CARD
Motif
Other DBs
NCBI-GeneID: 102949369
NCBI-ProteinID: XP_007076957
LinkDB All DBs
Position
Un
AA seq 1147 aa AA seqDB search
MNHFQTILPRVRMLLAGHLPSQARALLDSMLERELLSREYHCALLREPDGEALARKISLT
LLEKGDPGLALLRWAWGTWQAPLAERDPDDEDRARSGQCAAMELGPLEGGYLELLNSNAD
PLHLYHLYDQMDPAREEMELCSEPDMDTINCEQFSRLLCDMEGDEETREAYANIAELDQY
VFQDSQLEGLSKGFFIEHIGLEEMIGESVETLEEKKSQKRSFPEELPMDSKHRKLAEPLA
VPMVTGTFLVGSVSDSSALPCLSPPAVFNKEPASSQRWLKETILMPVPPSSSLLSCLSLS
AGHIQIVPTLPQGLWQISGAGTGVSGMVIYQGEVPQASQALPSSSPAIHSLPKSPERPGS
TSPFAPSASDLPGMPEPALTSRADVTEEQMSPTRSPAAHEVSSQLPKWPERVEKFCSALR
DVYQAEPAGPEGILVEVELVRARLERSSSKSQERELATLDWAERQPARGGLAEVLLGAPS
RLQELLFSLGPRPLPVDDEVFSYVWRRPDRVLLILDASEGLEGQDGLLHSACGPVCTEPH
SVRGLLAGLFQRKLLRGCTLLLTARPRGRLAQSLSKADALFEAAGFSAEQAKTYLTRYLE
RAGATERRERALELLQGQPFLLSHCHSPTLCRAVGQLSEALLELGGETELPSTLTGLYVG
LLGPAARDSPPGALAGLARLAWELGRRRQGTLPESQFPSAEARAWAVAKGLVQPAPGAAA
VGLAFSSFLLQCFLGAVWLALSSDIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLVF
QPHADCLGALAGPAAATLKDRKQKVLTRYLKRLQPGTLRAGQLLELLHCTRETLDAGLWQ
HVVQGLPARLSFVGTRLTPPHTYVLGSALEAAGRDFSLDLCSTGIDPPGLGSLVGLSCVT
HFRAALSDMVGLWESLQQRGEAKLLRAVEEKFTIEPFKAKSVKDVEDLGNLVQIQRTRSS
SEDTAGELPAVRDLKKLEFALGPVSGPQAFPKLVRILEAFSSLQHLDLDSLSENKIGDEG
VEQLSATFPRLKALETLNLSQNNITDVGACKLAEALPSLAASLLRLSVYNNCICDMGAES
LAHVLPDMGSLRVLDVQYNKFTAAGAQQLAASLRKCPHVETLAMWTPTIPFGVHEHLQQL
DSRISLK
NT seq 3444 nt NT seq  +upstreamnt  +downstreamnt
atgaaccacttccagaccatcctgcctcgggtccggatgctgctggccggccatctgccg
agccaggcccgggccctcctggacagcatgttggagagggagctcctctccagggagtac
cactgcgctctgctccgcgagcctgacggcgaggccctggccaggaagatctccttgacc
ctgctggagaaaggagacccaggcttggccctcttgaggtgggcatggggtacgtggcag
gccccgctggccgagagggaccccgacgacgaggaccgtgcccgcagtgggcagtgtgcc
gccatggagttggggcctctagaaggcggctacctggagcttctcaacagcaatgctgac
cccctgcatctctaccacctctatgaccagatggacccggctagagaagagatggagctc
tgctcagaacccgacatggacaccatcaactgcgagcagttcagcagactgttgtgtgac
atggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaactggaccagtac
gtgttccaggactcacaactggagggtctgagcaaaggctttttcatcgagcatatagga
ttggaagaaatgatcggcgagagtgtggagacgctggaggaaaagaaaagtcagaaaaga
tccttcccagaggagctgcccatggactcgaagcacaggaagctggctgagcccctcgct
gtgcccatggtgactggcactttcctggtggggtccgtgagtgactcctcagctctgccc
tgcctgtcaccccctgctgtgttcaacaaggagccagcatccagccagaggtggctgaag
gagaccatcctgatgcctgtgcccccttcaagttccttgctgagctgcctgagcctttct
gctggacacatccagatcgtccccactctgccccaggggctctggcaaatctcaggggct
gggacaggggtatctggtatggtcatctatcaaggtgaggtgccccaggccagccaggcg
cttccttccagcagccccgccatacacagcctccccaaatccccagaacgacccggctcc
accagcccctttgccccgtctgcgtctgaccttcccggaatgccggaaccagctctgacc
tcccgtgcagatgtgacagaggagcagatgtcccctacccgatccccggcagctcacgag
gtctccagccagctcccgaaatggcctgagcgggtggagaagttctgcagcgcccttcgg
gacgtgtaccaggctgagcccgcgggcccggaaggcatcctggtggaggtggaactggtg
agggcgcggctggaaaggagcagcagcaaaagccaggagagggagctggccaccctggac
tgggcagagcggcagccggcccgcgggggcctggccgaggtgctgctgggggccccctcc
cgcctccaggagctgctgttctccctgggcccccggcctctgccggtggacgatgaggtc
ttcagctacgtctggaggaggcccgaccgggttctgctcatcctggatgcctccgagggc
ctcgaaggccaggacggcctcctgcacagcgcgtgtggacccgtgtgcacagagccccac
tccgtccggggactgctggcgggcctcttccagcgtaagctgctgcggggctgcaccctg
ctgctcacggcccggccccggggccgcctggcccagagcctgagcaaggccgacgctctg
ttcgaggcggccggcttctcagccgagcaggccaagacctacctgacgcgctacttggag
cgcgcaggggcgaccgagcgccgagagagagccctggagctcctccagggtcagcctttc
ctcctcagccactgccacagccccactttgtgccgggccgtgggccagctgtccgaggcc
ctcctggagctggggggggagacggagctgccctccacgctcacgggactctacgtgggc
ctgctcggccctgccgcccgcgacagccccccgggggccctggcgggactggccaggctg
gcctgggagctgggccgcagacgccagggcaccttgccggagagccagttcccgtcggcg
gaggcgagggcctgggccgtggccaagggcttggtgcagcccgccccaggggccgcggcg
gtggggctggccttctccagcttccttctgcagtgcttcctgggggccgtgtggctggcc
ctgagcagcgacatcaaggacaaggagctgccacagtacttggcgttgaccccgaggaag
aagaggccctacgacaactggctggagggcgtgccgcgcttcctggcggggctggttttc
cagccgcatgccgactgcctcggggccctggcggggcctgcggcggccaccctgaaggac
aggaagcagaaagtgctcaccaggtacctgaagcggctgcagccggggacgctgcgggcc
ggacagctgctggagctgctgcactgcacccgtgagactttggacgccgggctctggcag
cacgtggtgcaggggctccccgcccgcctctccttcgtgggcacccggctcacgcctccc
cacacctatgtcctgggcagcgccttggaggcggcgggccgagacttctccctggacctc
tgcagcactggcattgacccccctggactggggagcctcgtgggactcagctgcgtcacc
catttcagggctgcgctgagtgacatggtggggctgtgggagtctctacagcagcgtggg
gaggccaagctgctccgggcggtggaggagaagttcaccatcgagcctttcaaggccaag
tccgtgaaggatgtggaagatctgggcaacctcgtgcagatccagaggacaagaagttct
tcagaagatacggctggagaactccctgcggtccgggatctaaagaagctggagttcgcg
ctgggccccgtctcaggcccccaggcttttcccaagctggtgaggatcctcgaggccttt
tcctcccttcagcatctggacctggactcgctgagcgagaacaagattggcgacgagggt
gtcgagcagctgtcggccaccttccctcggctcaaggccctggagaccctcaacttgtcc
cagaacaacatcaccgacgtgggcgcctgcaagctcgccgaggccctgccctcgctggct
gcatccctcctcaggctcagtgtatacaataactgcatctgtgacatgggagccgaaagc
ctggcgcacgtgcttccagacatggggtccctccgggtgctggatgtccagtataacaag
ttcacagccgccggggcccagcagctggccgccagcctgagaaagtgccctcacgtggag
acgctggcgatgtggacgcccaccatcccgtttggcgtccacgagcacctacagcagcta
gattcgcggatcagcctgaagtga

DBGET integrated database retrieval system