KEGG   Panthera tigris altaica (Amur tiger): 102958303Help
Entry
102958303         CDS       T02988                                 

Gene name
TAP2
Definition
(RefSeq) transporter 2, ATP binding cassette subfamily B member
  KO
K05654  ATP-binding cassette, subfamily B (MDR/TAP), member 3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg02010  ABC transporters
ptg04145  Phagosome
ptg04612  Antigen processing and presentation
ptg05163  Human cytomegalovirus infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    102958303 (TAP2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102958303 (TAP2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102958303 (TAP2)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    102958303 (TAP2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102958303 (TAP2)
   05168 Herpes simplex virus 1 infection
    102958303 (TAP2)
   05163 Human cytomegalovirus infection
    102958303 (TAP2)
   05169 Epstein-Barr virus infection
    102958303 (TAP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptg02000]
    102958303 (TAP2)
Transporters [BR:ptg02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    102958303 (TAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran AAA_22 SMC_N AAA_21 AAA_29 AAA_30 AAA_16 AAA_23 AAA_15 AAA_25 SRP54 AAA_33 RsgA_GTPase APS_kinase RNA_helicase
Motif
Other DBs
NCBI-GeneID: 102958303
NCBI-ProteinID: XP_007093314
LinkDB All DBs
Position
Un
AA seq 588 aa AA seqDB search
MWALLSSPGAQEKQGQENNTDLMWKLLKLSRPDLPFLLLAFIFLGGAVWGETWIPYYTGR
VIDILGGDFKPDAFASAIFSMCVISVVSSLCAGSRGGIFTFTQSSINVRVREQLFSSLLR
QDLSFFQETKTGELNSRLSSDTKMLSQWLAFNANVLLRSLVKTVGLYCFMISLSPRLTLL
SLLEMPLVIAGEKMYNVRHQAVLQEIQNAVAKAGQVVREAVGGLQTVRSFGAEDLEICLY
KEALERCRQLWWQRDLERTLYGLFRRMLSLGMQALMLYRGLQQILAGDLTQGALLSFLLY
QEVAAKHVHALVYMCGDMVCNIGAAEKVFQYLDREPNMPPLGTLAPSTLQGLVEFQDVSF
AYPNCPDQPVLKGLTFTLHPGQMTALVGPNGSGKSTVAALLQNLYQPTKGQVLLDGRPVS
QYEHCYLHQQVASVGQEPVLFSGSVRDNIAYGLKSCGDEKVMAAVRGAGADRFIQEMEHG
LDSDVGEKGNQLAVGQKQCLAIARALVRDPQVLILDEATSALDVQCEQSLQDWRSRGDRT
VLVIAHRLQTVQSADQILVLRQGELLEHTQLAEGQDLYSRLLQTQLED
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccctgctgagctctccaggagcccaggagaagcagggccaggagaacaacaca
gacttgatgtggaagctgctgaagctctccaggccagacctgccttttctccttttggcc
ttcatcttccttggtggtgccgtatggggggagacatggatcccttactatactggtcgt
gtcattgacatccttggaggggatttcaagcctgacgcctttgccagcgccatcttttcc
atgtgcgtcatatccgttgtgagctcactgtgcgcaggctcccgaggaggcatcttcacc
ttcacccagtccagtatcaacgtgcgggtcagggagcagcttttctcctcccttctgcgc
caggacctcagtttcttccaggagactaagacaggggaactgaattcaaggttgagctcg
gataccaaaatgttgagccagtggcttgcttttaatgccaatgtgctcttgcgaagcctg
gtcaaaacggtggggctgtattgcttcatgatcagcctgtcccctcgactcaccctcctc
tctttgctcgagatgcctctggtaatagctggtgaaaagatgtacaatgtccgccatcag
gcagtgctccaggagatccagaacgcagtggcaaaagcagggcaggtggtgcgggaggca
gttggagggctgcagactgtgcgcagttttggggccgaggatctggagatctgtctctat
aaggaggccctggagcgatgccggcagctgtggtggcaacgagacctggaacgtaccctc
tatgggctctttcggaggatgctgagtttgggaatgcaggcactgatgctgtaccgtgga
ctgcagcagattctggctggggacctcacccagggtgcactgctctcctttctgctctac
caggaggtggcggccaagcatgtgcatgccctggtatacatgtgtggagatatggtctgc
aacataggggctgctgagaaagttttccaatacctggaccgagagccaaatatgcctcct
ttggggacgctggcgccttccactctgcaggggcttgtggaattccaagatgtctctttt
gcatatcccaattgccctgaccagcctgtgctcaaggggctgacgttcaccctacatcct
ggtcagatgactgcactggtgggacccaatgggtctgggaagagcaccgtggctgccctg
ctgcagaatctgtatcagcccactaaagggcaggtgctgctggacgggaggcccgtctcc
cagtatgaacactgctatctgcaccagcaggtggcttcggttgggcaggagcctgtgctg
ttctcgggttctgtgagggacaacattgcttatgggctgaagagctgcggtgatgagaag
gtgatggctgctgtccgcggtgccggtgcagacaggttcatacaggagatggagcatgga
ctggattcagatgtaggggagaaagggaatcagttggctgtgggacagaaacaatgtctg
gccatcgcccgggcccttgtgcgggacccacaagtcctcatcctggatgaagccaccagt
gccctggacgtccagtgtgagcagtctctgcaggactggagatcccgcggggaccgaacg
gtgctggtgatcgcgcacaggctgcagacggtgcagagtgcggaccagatcctggtgctc
aggcagggagagctgctggagcacactcagctcgccgaggggcaggacctctattcccgt
ctgctgcagacacaactggaggactga

DBGET integrated database retrieval system