KEGG   Panthera tigris altaica (Amur tiger): 102958542
Entry
102958542         CDS       T02988                                 

Gene name
PRDX6
Definition
(RefSeq) peroxiredoxin 6
  KO
K11188  peroxiredoxin 6 [EC:1.11.1.7 1.11.1.27 3.1.1.-]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00480  Glutathione metabolism
ptg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102958542 (PRDX6)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     102958542 (PRDX6)
    1.11.1.27  glutathione-dependent peroxiredoxin
     102958542 (PRDX6)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     102958542 (PRDX6)
SSDB
Motif
Pfam: AhpC-TSA 1-cysPrx_C Redoxin Gmad1
Other DBs
NCBI-GeneID: 102958542
NCBI-ProteinID: XP_007084089
LinkDB
Position
Un
AA seq 210 aa
MTVIIPPISCGFLFLHLRWGILFSHPRDFTPVCTTELGRAAKLAPEFAKKNVKMIALSVD
SVEDHLAWSKDINAYNGQEPTEKLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVV
FIFGPDKKLKLSILYPATTGRNFDEILRVITSLQLTAEKRVATPVDWKDGDSVMVLPTIP
EDEAKKIFPKGVFTKELPSGKKYLRYTPQP
NT seq 633 nt   +upstreamnt  +downstreamnt
atgacggtgataatccctccaataagctgtggcttccttttccttcatctcagatggggc
attctcttctcgcaccctcgggatttcacccccgtgtgtaccacggagctcggcagagcc
gcaaagctggcacccgaatttgccaagaagaacgtgaaaatgattgccctctcagtggat
agtgttgaagaccatcttgcctggagcaaggatatcaatgcttacaatggtcaggagccc
acagaaaaattacctttccccatcattgatgataagaatcgggaccttgccatcctgtta
ggcatgctggacccagcagagaaggacgaaaagggcatgcctgtgacagctcgtgtggta
tttatctttggtcctgataagaagctgaagctgtctatcctctacccagcaaccactggc
aggaactttgatgagattctcagggtaattacctctctccagctgacagcggaaaagagg
gttgccacccccgttgattggaaggatggcgatagcgtgatggttcttccaaccatccct
gaagatgaagccaaaaaaattttccctaaaggagtcttcaccaaagagctcccgtctggc
aagaagtacctccgttacacgccccagccgtag

DBGET integrated database retrieval system