KEGG   Panthera tigris altaica (Amur tiger): 102959921Help
Entry
102959921         CDS       T02988                                 

Gene name
EOGT
Definition
(RefSeq) EGF domain specific O-linked N-acetylglucosamine transferase
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102959921 (EOGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ptg01003]
    102959921 (EOGT)
Enzymes [BR:ptg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     102959921 (EOGT)
Glycosyltransferases [BR:ptg01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   102959921 (EOGT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-GeneID: 102959921
NCBI-ProteinID: XP_007096398
LinkDB All DBs
Position
Un
AA seq 535 aa AA seqDB search
MQVGLEVAMLMLLILGVLLHGVSLSGQEEASPKADGIPGEPLFNYASIRLPQEHIPFFLH
NNRHVATVCKKDSHCPYKKHLENLKFCWGYEKSCKPEFRFGYPLCTYVDMGWTDTLESAQ
DIFWKQADFGYAGERLEELHVLCQPEETNDSSLVCSRYLQYCRATNLYLDLRNIKRDHDR
FKEDFFQSGEIGGHCTLDIHTLMSQGQRKSPLQSWFAELQSYTQLSFRPIEATECDVVIE
KPTYFMKLDAGVNMYHHFCDFINLYITQHVNNSFSTDVYIVMWDTSSYGYGDLFSDTWRA
FTDYDVIHLKTYDSKRVCFKEAIFSLLPRMRYGLFYNTPLISGCQNTGLFRAFSQHVLHR
LNITQEGPKDGRIRVTILARSTEYRKILNQNELVNALKTVSTLEVRIVDYKYKALGFLDQ
LRISHNTDIFIGMHGAGLTHLLFLPDWAAVFELYNCGDERCYLDLARLRGIHYITWRRQN
KVFPQDKGHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKRDEL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgggtttggaggttgctatgttaatgctgcttattcttggagtattgcttcat
ggtgtttcactgagtggccaagaggaggcttctcccaaggctgatggcattccaggcgaa
cctctgtttaactacgccagcattcgcttgccccaggaacacattcccttctttttgcac
aataataggcacgttgccacggtctgtaagaaagactcccattgtccttataagaaacac
ttagagaatctaaagttctgctggggttatgagaaatcctgcaaaccagagttcaggttt
ggctaccctctttgtacctacgtcgacatgggatggacagatacccttgaatcagcccag
gacatattctggaaacaagctgactttggatatgccggagagcgactggaagaacttcac
gtgctctgccagcctgaggaaacgaatgactcaagtctggtatgttcccgttatcttcag
tactgcagagcaaccaatctctatcttgatttaagaaacatcaagagagaccatgacaga
tttaaggaagattttttccagagtggcgaaattggaggacactgtacgcttgacattcat
acattgatgtctcaaggtcagcgcaaaagccctctgcagtcctggtttgctgagctacaa
agctatactcagctctccttcagacccatagaagctactgaatgtgacgttgttattgaa
aaaccaacctacttcatgaaactggatgcaggtgttaacatgtatcaccacttctgtgat
tttatcaatctttatattactcagcacgttaataattcattcagtacagatgtgtacatc
gtgatgtgggacaccagctcctatggatatggtgacctattctctgacacatggagagca
tttacggattatgatgttatacatttgaaaacttatgattccaaaagggtgtgttttaaa
gaagctattttttccctactcccccggatgcgatacgggctgttctataatacccctttg
atatctggctgtcagaacacgggattattcagggcattttcccagcatgtgctgcacaga
ctgaacatcacacaggagggccccaaggatggaagaatccgagtcaccattcttgcacgg
agtacagagtaccggaaaattctaaaccaaaacgagctggtaaatgcactgaagacagta
tctacacttgaggttcggattgtcgattacaagtataaggcacttgggtttttagatcag
ctgaggatcagtcataacacggacatatttatcggaatgcatggagctggtcttacccat
ttactcttccttccagactgggctgctgtctttgaactgtacaactgtggagatgagcgc
tgctacttagacctggccaggctcagagggatccattacatcacttggcgaaggcagaat
aaagtctttcctcaggataagggccaccacccgactctgggggaacatccaaagtttacc
aactactctttcgatgtagaagaattcatgtaccttgtccttcaggcggcagaccacgta
ttacaacacccgaaatggccgtttaagaaaaaacgtgatgagctataa

DBGET integrated database retrieval system