KEGG   Panthera tigris altaica (Amur tiger): 102964419
Entry
102964419         CDS       T02988                                 

Gene name
CALR
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04141  Protein processing in endoplasmic reticulum
ptg04145  Phagosome
ptg04612  Antigen processing and presentation
ptg05142  Chagas disease
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05168  Herpes simplex virus 1 infection
ptg05169  Epstein-Barr virus infection
ptg05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102964419 (CALR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102964419 (CALR)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    102964419 (CALR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102964419 (CALR)
   05170 Human immunodeficiency virus 1 infection
    102964419 (CALR)
   05168 Herpes simplex virus 1 infection
    102964419 (CALR)
   05163 Human cytomegalovirus infection
    102964419 (CALR)
   05169 Epstein-Barr virus infection
    102964419 (CALR)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    102964419 (CALR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ptg03110]
    102964419 (CALR)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:ptg04091]
    102964419 (CALR)
Chaperones and folding catalysts [BR:ptg03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   102964419 (CALR)
Lectins [BR:ptg04091]
 Calnexin / calreticulin
  102964419 (CALR)
SSDB
Motif
Pfam: Calreticulin MDM10
Other DBs
NCBI-GeneID: 102964419
NCBI-ProteinID: XP_007098250
LinkDB
Position
Un
AA seq 410 aa
LLGLLGLAAAEPTVYFKEQFLDGEGWTDRWIESKHKSDFGKFVLSSGKFYGDQEKDKGLQ
TSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPEGLDQTDMHGDSE
YNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKID
NSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDA
KKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYA
YENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRL
KEEEEDKKRKEEEEADKEDEEDKDEEDEDEDEKEEEEEEDAATGQAKDEL
NT seq 1233 nt   +upstreamnt  +downstreamnt
ctgctcggcctcctcggcctggccgccgccgagcccaccgtctacttcaaggagcagttt
ctggacggagaggggtggaccgaccgctggattgaatccaaacacaagtcagattttggt
aaatttgttctgagttccggcaagttctacggtgaccaggaaaaggataaagggctgcag
acaagccaggatgcccgcttttatgccttgtcggccagatttgagccctttagcaacaag
ggccagacgctggtggtgcagttcacagtaaaacacgagcagaacatcgactgtgggggc
ggctacgtgaagctatttccagagggcttggaccagacggacatgcacggagactctgaa
tacaacatcatgtttggcccggatatctgtggccctggcaccaagaaggttcatgtcatc
tttaactacaagggcaagaacgtgctgatcaacaaggacattcgttgcaaggatgatgaa
ttcacacacctgtatacgctgattgtgcggccggataacacctatgaggtgaagatcgac
aacagccaggtggagtcgggctccttggaggatgattgggacttcttgcctcccaagaag
ataaaggatcctgatgctgcgaagcctgaagactgggacgagcgggccaagattgatgac
cccacagactccaagcctgaggactgggacaaacccgagcacattcctgaccctgatgct
aaaaagccagaggactgggatgaggagatggacggagagtgggaaccaccagtgattcag
aaccctgagtacaagggcgagtggaagccccggcagatcgacaacccagattacaagggc
acttggatccacccagagatcgacaaccccgagtactcccctgatagcaacatctatgcc
tatgaaaactttgctgtcctgggcttagatctctggcaggtcaagtctggcaccattttt
gacaacttcctcatcaccaacgacgaggcgtatgcagaggagtttggaaacgagacctgg
ggtgtcacgaaggcggcggaaaagcagatgaaggacaagcaagatgaggaacagagacta
aaggaggaagaggaggataagaagcgtaaggaagaggaggaggcagacaaggaagacgag
gaagacaaggatgaggaggacgaggacgaggatgagaaggaggaggaggaggaggaagat
gctgccactggccaggccaaggacgagctgtag

DBGET integrated database retrieval system