Panthera tigris altaica (Amur tiger): 102965909 Help Entry 102965909         CDS       T02988                                  Symbol POLR2G Name (RefSeq) RNA polymerase II subunit G   KO K03015   DNA-directed RNA polymerase II subunit RPB7 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03020   RNA polymerase ptg03420   Nucleotide excision repair ptg05016   Huntington disease Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     102965909 (POLR2G)   09124 Replication and repair    03420 Nucleotide excision repair     102965909 (POLR2G)  09160 Human Diseases   09164 Neurodegenerative disease    05016 Huntington disease     102965909 (POLR2G)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ptg03021]     102965909 (POLR2G)    03019 Messenger RNA biogenesis [BR:ptg03019]     102965909 (POLR2G)    03400 DNA repair and recombination proteins [BR:ptg03400]     102965909 (POLR2G) Transcription machinery [BR:ptg03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      102965909 (POLR2G) Messenger RNA biogenesis [BR:ptg03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      102965909 (POLR2G) DNA repair and recombination proteins [BR:ptg03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       102965909 (POLR2G) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S1 SHS2_Rpb7-N Motif Other DBs NCBI-GeneID:  102965909 NCBI-ProteinID:  XP_007092003 LinkDB All DBs Position Un AA seq 172 aa AA seqDB search MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD PNSNPPCYKTMDEDIVIXQDDEIRLKIVGTGVDKNDIFAIGSLMDDYLGLVS NT seq 519 nt NT seq  +upstreamnt  +downstreamnt atgttctaccacatctccctggagcacgagatcctgttgcacccgcgctacttcggcccc aacctgctcaacacggtaaagcagaagctcttcaccgaggtggaggggacctgcactggc aagtatggctttgtgattgctgtcaccaccattgacaatattggtgctggtgtgatccag ccaggccgaggctttgtcctttatccagttaagtacaaggccattgtgttccggcccttt aaaggggaggtcgtggatgctgttgtcactcaagtcaacaaggttggactcttcacagaa attggacctatgtcctgcttcatctctcggcattccatcccatcagagatggagtttgat cctaactccaacccgccatgttacaagacgatggatgaggacattgtgatttagcaggat gatgagatccgcttgaagatcgtggggacaggagtggacaagaatgacatttttgctatc ggctccctgatggacgattacttggggcttgtgagctga

DBGET integrated database retrieval system