KEGG   Panthera tigris altaica (Amur tiger): 102967384
Entry
102967384         CDS       T02988                                 

Gene name
IMPDH1
Definition
(RefSeq) inosine monophosphate dehydrogenase 1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Module
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102967384 (IMPDH1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102967384 (IMPDH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102967384 (IMPDH1)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     102967384 (IMPDH1)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102967384 (IMPDH1)
  Exosomal proteins of breast cancer cells
   102967384 (IMPDH1)
SSDB
Motif
Pfam: IMPDH CBS FMN_dh NMO His_biosynth NanE ThiG Glu_synthase DHO_dh G3P_antiterm
Other DBs
NCBI-GeneID: 102967384
NCBI-ProteinID: XP_015391165
LinkDB
Position
Un
AA seq 445 aa
MDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGD
VLEAKIRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTTRNELVVAP
AGVTLKEANEILQRSKKGKLPIVNDRDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAA
VGTREDDKYRLDLLTQAGADVIVLDSSQGNSVYQIAMVHYIKQKYPQLQVIGGNVVTAAQ
AKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQT
VGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKR
YFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELK
FEKRTMSAQIEGGVHGLHSYEKRLY
NT seq 1338 nt   +upstreamnt  +downstreamnt
atggacactgtgacagaagctgacatggccattgcgatggctctgatgggcggtattggt
ttcattcaccacaactgcaccccggagttccaggccaatgaagtgcggaaggtcaagaaa
tttgaacagggattcatcacagaccccgtagtgctaagcccctcacacactgtgggcgac
gtgttggaggccaagatccggcatggcttttcgggcatccctatcactgagacaggcacc
atgggcagcaagctggtgggcatcgtaacctcccgagacattgactttcttgccgagaag
gaccacaccaccctccttagcgaggtgatgactacgcggaatgagctggtggtggctccg
gcgggtgtgacattgaaagaggcaaatgagatcctgcaacgcagcaagaaagggaagctg
cccattgtcaatgatcgtgatgagctcgtggccatcattgcccgcactgacctgaagaag
aacagggattaccctctggcctccaaggattcccacaagcagctgctgtgcggggcggcc
gtgggcacgcgtgaggatgacaagtaccgcttggacctgctcacccaggcaggcgccgat
gtcattgtgctggactcctcccaagggaactctgtgtatcagatcgccatggtacactac
atcaagcagaagtacccccagctccaggtgattggggggaatgtggtgacagcagctcag
gccaagaacttgatcgatgctggtgtggacgggctgcgtgtggggatgggctgtggctcc
atctgcatcacccaagaagtgatggcctgcggtcggccccagggcactgctgtgtacaag
gtggccgagtatgcccggcgctttggggtgccggtcatcgctgatggtggcatccagacc
gtgggtcatgtggtcaaagccctggcccttggagcctccacagtgatgatgggctccctg
ctcgccgccaccacggaggcccctggcgagtacttcttctcggatggggtgaggctcaag
aaataccggggcatgggctcgttggatgccatggagaagagcagcagcagccagaaacga
tacttcagcgagggggacaaggtgaagatcgcacagggggtctcgggctccatccaggac
aaaggctccattcagaagttcgtgccctacctcatagcaggtatccagcacggctgccag
gatatcggtgcccgtagcctgtcagtcctgcggtccatgatgtattcaggggagctcaag
tttgagaagcggaccatgtcggctcagatcgagggtggtgtccatggcctgcactcttac
gagaagcggctgtactga

KEGG   Panthera tigris altaica (Amur tiger): 102970926
Entry
102970926         CDS       T02988                                 

Gene name
IMPDH2
Definition
(RefSeq) inosine monophosphate dehydrogenase 2
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg00230  Purine metabolism
ptg00983  Drug metabolism - other enzymes
ptg01100  Metabolic pathways
Module
ptg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102970926 (IMPDH2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102970926 (IMPDH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ptg04147]
    102970926 (IMPDH2)
Enzymes [BR:ptg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     102970926 (IMPDH2)
Exosome [BR:ptg04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102970926 (IMPDH2)
  Exosomal proteins of breast cancer cells
   102970926 (IMPDH2)
SSDB
Motif
Pfam: IMPDH NMO CBS FMN_dh His_biosynth NanE ThiG Dus Glu_synthase G3P_antiterm DUF561 B12-binding
Other DBs
NCBI-GeneID: 102970926
NCBI-ProteinID: XP_007088552
LinkDB
Position
Un
AA seq 514 aa
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMT
KREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKEKYPSLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVP
VIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAM
DKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVR
AMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccgactacctgattagcgggggcacgtcctacgtgccagacgacgggcttacggca
cagcagctgttcaactgcggggacggcctcacctacaatgactttctcattctccctggg
tacatcgacttcactgcagaccaggtggacctgacttctgctctgaccaaaaagattact
ctgaagaccccactggtttcctcacccatggacacagtcacagaggctggcatggccata
gcaatggcgcttacaggtggtattggtttcatccaccacaactgtacaccggagttccaa
gccaacgaagttcggaaagtgaagaaatatgagcagggattcatcacagaccctgtggtc
ctcagccccaaggatcgagtgcgggatgtgtttgaagccaaagctcggcatggtttctgt
ggtatcccaataactgacacaggacggatgggaagccgcctggttggcatcatttcctca
agggacattgattttctcaaggaggaggagcacgaccggtttttggaagagatcatgacg
aagagggaagacttggtggtagctcctgcaggcatcacattgaaagaagcaaatgaaatt
ttgcagcgcagcaagaaaggaaagttacccattgtaaatgaagatgatgaactggtagcc
atcattgcccggacagacctgaagaagaaccgggattacccactggcctccaaagatgcc
aagaagcagctgctctgtggagcagccattggcactcatgaagatgacaagtatcggctg
gacttgctagcccaggctggtgtggatgtagtggttttggactcttcccagggaaattca
atcttccagatcaacatgatcaagtacatcaaagagaaataccccagtctccaagttatt
ggaggcaatgtggtcacagctgctcaggccaagaacctcattgatgctggcgtagatgcc
ctgcgggtgggcatgggcagtggctccatctgcatcacccaggaagtgctggcctgcggg
cggccccaagcaacagcagtatacaaggtgtcagaatatgcacggcgctttggtgttcct
gttattgctgatggaggaatccaaaatgtgggccacatcgctaaagccttggcccttggg
gcctccacagttatgatgggctccctcctggctgctactactgaggcccctggcgagtac
ttcttctctgatggaatccggctaaagaaatatcgtggtatgggttctcttgatgccatg
gacaagcatctcagcagccagaaccgatatttcagtgaagctgacaaaatcaaggtggct
cagggggtgtctggggctgtgcaggacaaagggtccatccacaaatttgtcccctacctg
attgctggcatccagcactcctgccaagacattggtgccaagagtttgacccaagtccga
gccatgatgtattctggagaactcaagtttgagaagagaacatcctcagctcaggtggaa
ggtggtgtccacagcctccattcgtatgagaagaggcttttctga

DBGET integrated database retrieval system