KEGG   Panthera tigris altaica (Amur tiger): 102969678
Entry
102969678         CDS       T02988                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04022  cGMP-PKG signaling pathway
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04370  VEGF signaling pathway
ptg04380  Osteoclast differentiation
ptg04625  C-type lectin receptor signaling pathway
ptg04650  Natural killer cell mediated cytotoxicity
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04921  Oxytocin signaling pathway
ptg05135  Yersinia infection
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102969678 (NFATC2)
   04370 VEGF signaling pathway
    102969678 (NFATC2)
   04022 cGMP-PKG signaling pathway
    102969678 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102969678 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102969678 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    102969678 (NFATC2)
   04660 T cell receptor signaling pathway
    102969678 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    102969678 (NFATC2)
   04659 Th17 cell differentiation
    102969678 (NFATC2)
   04662 B cell receptor signaling pathway
    102969678 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102969678 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    102969678 (NFATC2)
   04380 Osteoclast differentiation
    102969678 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102969678 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102969678 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102969678 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    102969678 (NFATC2)
   05161 Hepatitis B
    102969678 (NFATC2)
   05163 Human cytomegalovirus infection
    102969678 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102969678 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102969678 (NFATC2)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102969678 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102969678
NCBI-ProteinID: XP_015395207
LinkDB
Position
Un
AA seq 459 aa
MRVIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQ
LHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLE
PKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPEASGRIISLQTAS
NPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTAESKVVFTEKTTDGQQIWEM
EATVDKDKSQPNMLFVEIPEYRNKHIRASVKVNFYVINGKRKRSQPQHFTYHPVPAIKTE
PTDEYDPTLICSPAHGGLGSQPSFPQHPMVAESPSCLAATTAACPPPTGQQLRCGGHQEF
QHIMYCENFAPGTARPGPPPASQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVL
PAGVTIKQEQNLDQTYLDDGKGVFKQQPRERDPRVWLMG
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgagagttattccagtgaccgcatccctccctccgcttgagtggccactctcccaccag
tcggggtcctatgagctgcggattgaggtgcagcccaagccacatcaccgggcccactat
gagacagaaggcagccgaggggctgtcaaagctccaactggtggccaccctgtcgttcag
ctccatggctacatggaaaacaagcccctcgggcttcagatcttcattgggacagccgac
gagcggatccttaagccccacgccttctaccaggtgcaccgcatcacgggaaaaaccgtc
accaccaccagctacgagaagatcgtaggcaacaccaaagtcctggagatccctctggag
ccaaagaacaacatgagggcgaccattgactgtgcggggatcctgaagctgaggaatgcg
gacatcgagctgcggaaaggcgagacggacatcggcaggaagaacacgcgggtgcggctg
gttttccgggtgcacattccagaggccagcgggaggatcatctccctgcagactgcatcc
aaccccatcgaatgctcccagcgatccgcccacgagctgcccatggtggaaagacaggac
atcgacagctgcctggtctacgggggccaacagatgatcctcacgggacagaacttcaca
gccgagtccaaagtcgtgtttactgagaagaccacagatgggcagcaaatttgggaaatg
gaagccacggtggataaagacaagagccagcctaacatgctttttgttgagatccctgaa
tatcgaaacaagcacatccgtgcatcggtgaaggtcaacttctacgtcatcaatgggaaa
agaaaacggagtcaacctcagcactttacttaccacccagtcccagccatcaagacggaa
cccaccgacgaatacgaccccaccttgatctgcagcccggcccacgggggcctggggagc
cagccttccttcccacagcacccgatggtggctgagtccccctcctgcctcgcggccacc
acggcggcctgcccaccgcccaccggccagcagctgcgctgcggtggccaccaggaattc
cagcacatcatgtactgcgagaatttcgcgcccggcaccgccaggcccggcccgcccccc
gccagtcaaggtcagaggctgagcccggggtcctaccccacggtcattcagcagcagaat
gccaccagccaaagagccgccaaaaacggacccccggtcagtgaccaaaaggaagtatta
cccgcaggagtgacaattaagcaggagcagaatttggaccagacctacttggacgacgga
aaaggagttttcaaacagcaaccaagggaacgtgacccaagagtctggcttatgggctga

KEGG   Panthera tigris altaica (Amur tiger): 102972106
Entry
102972106         CDS       T02988                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04010  MAPK signaling pathway
ptg04022  cGMP-PKG signaling pathway
ptg04218  Cellular senescence
ptg04310  Wnt signaling pathway
ptg04360  Axon guidance
ptg04625  C-type lectin receptor signaling pathway
ptg04658  Th1 and Th2 cell differentiation
ptg04659  Th17 cell differentiation
ptg04660  T cell receptor signaling pathway
ptg04662  B cell receptor signaling pathway
ptg04921  Oxytocin signaling pathway
ptg05135  Yersinia infection
ptg05161  Hepatitis B
ptg05163  Human cytomegalovirus infection
ptg05166  Human T-cell leukemia virus 1 infection
ptg05167  Kaposi sarcoma-associated herpesvirus infection
ptg05170  Human immunodeficiency virus 1 infection
ptg05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102972106 (NFATC3)
   04310 Wnt signaling pathway
    102972106 (NFATC3)
   04022 cGMP-PKG signaling pathway
    102972106 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102972106 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102972106 (NFATC3)
   04660 T cell receptor signaling pathway
    102972106 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    102972106 (NFATC3)
   04659 Th17 cell differentiation
    102972106 (NFATC3)
   04662 B cell receptor signaling pathway
    102972106 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102972106 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    102972106 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102972106 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102972106 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102972106 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    102972106 (NFATC3)
   05161 Hepatitis B
    102972106 (NFATC3)
   05163 Human cytomegalovirus infection
    102972106 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102972106 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptg03000]
    102972106 (NFATC3)
Transcription factors [BR:ptg03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    102972106 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 102972106
NCBI-ProteinID: XP_007090467
LinkDB
Position
Un
AA seq 1073 aa
MGSSIGSGPLPKWCLLVVALPAWCGEKADPVKYLEPDDCASIYIFNVDPPPSTLNSPLCL
PHHGLPSHSSVLSPSFQLQGHKNYEGTCEIPESKYSPLSGPKPFECPSIQITSISPNCHQ
EIDTHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSC
ESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQSPC
HSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHSPR
GSVTEDTWLNASVQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATILPGKLELCSDDQ
GSLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLDW
PLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFI
GTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILK
LRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELPHI
EKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHIVL
EVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPSLSVPH
PAQTQRPSSDTGHPHNSVLSTQRSLVCPIQQTYASMVTSSHLPQLQCRDESAGKEQHMLP
SSVMHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPVNAASSQEFDPVLFPQDAALPTLI
NLGCQPSSSIPFHSSNSGPTGHLLAHTPHSVQTLPHLQSMGYHCSTTGQRSLSSPGADQV
AGQPPPQLQPITYGPSHSGSGTAASPVASHPLASSPLSGPPSPQLQPMPYQSPSSGTASS
PSLATRMHSGQHSTQAQSTGQGGLSAPSSLICHNLCDPASFPPDEATVNIKPEPEEQEPN
FSTIGLQDITLDDVNEIIGRDMSQISVSQGTGASRQAPLPGPDSLDLGRSDGL
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgggatcttcgattgggtcggggccgctgcccaagtggtgtctgcttgtcgttgctttg
ccagcgtggtgcggagaaaaagctgaccctgtgaagtatcttgagccagatgattgtgca
tccatttacatctttaatgtagatccacctccatctactttaaactcaccactttgctta
ccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctccaaggt
cacaaaaactatgaagggacttgtgagattcctgaatctaaatacagccctttaagtggt
cccaaaccctttgagtgtccaagtattcaaattacatccatctctcctaactgtcatcaa
gaaatagatactcatgaagatgacctacacataaatgatccagaaagggaatatttggaa
aggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtcttccctt
agtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcatcttcttgc
gaatctctttcacacatttatgatgatgtggattcggaattgaatgaagctgccgcccga
tttactcttggatcccctctgacttctcctggtggctcaccaggaggttgccctggagaa
gagtcctggcatcaacaatatggacttggacactccttgtcacccaggcaatctccttgc
cactctcctagatctagtgttactgatgagaattggctgagccccaggccagcctcagga
ccctcatcaaggcctacttccccctgtgggaagcgacggcactccagtgctgaggtttgt
tatgctgggtccctttcaccccatcattcacctgttccttctcctggtcactcccccagg
ggaagtgtaacagaagatacctggcttaatgcttctgtccagggtggatcaggccttggc
cctgcactttttccatttcagtactgtgtagagactgatatccctctgaaaacaaggaag
acttctgaagatcaagctaccatactaccaggaaaattagagctctgttcagatgaccaa
gggagtttatcaccatcccgggagacttcagtagatgatggccttggatctcagtatcct
ttaaagaaagattcatctggtgaccaatttctttcagttccttcaccttttacctggagc
aaaccaaagcctggccacaccccaatatttcgcacatcttcattacctccactagactgg
cctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaaactcat
catcgagcccattatgaaactgaaggtagccgaggagcagtaaaagcatctactggggga
catcctgttgtcaagctcctgggctataatgaaaagccgataaatctacagatgtttatt
ggaacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcgaatcact
gggaagactgttgctactgcaagtcaagagataataattgccagcacaaaggttctggaa
attccccttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtattttgaaa
ctccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaagaatact
agagtacgacttgtattccgtgtgcacatcccacagcccaatggaaaagtcctttctctt
cagacagcttccatacctgttgagtgctctcagcggtctgctcaagaacttcctcatatt
gagaagtatagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtgactgga
tctaattttcttccagaatccaaaatcatttttcttgagaaaggacaagatggacgacct
cagtgggaggtagaagggaaaataatccgggaaaaatgtcaaggggctcacattgtcctt
gaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttttatctt
tgcaatggcaagaggaaaaaaagccaatctcaacgttttacttatacaccagttttgatg
aagcaagaacacaaagaagaggttgacttgtcttcagttccgtcattgtctgtgcctcat
cctgcccagacccagaggccttcttcagacacaggacacccacataacagtgtactgtca
acacagagaagcttggtttgtcccatccagcaaacatatgcatccatggtaacttcatct
catctgccacagttgcagtgtagggatgaaagcgctggtaaagagcagcatatgttacct
tcttcagtcatgcaccagccttttcaagtcacaccaacacctcctgtggggtcttcctat
cagcctatgcaaactaatgttgtgtacaacggaccaacttgtcttccagttaatgctgcc
tctagtcaagaatttgatccggttttgtttccacaggatgcagctcttcctactttaata
aatcttggctgtcaaccatcgtcatccataccttttcattcttcaaattcaggcccaaca
ggacatctcttagcccacacacctcattcagtacagaccctgcctcatctgcagtcaatg
ggataccattgttcaaccacaggacagagatctctttcttctccaggggctgaccaggtc
gcaggccagcctccccctcagttacagcccattacatatggtccttcacattcagggtct
ggtacagcagcttccccagtagcctctcatcccctggctagttcaccactttctgggcca
ccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcctcatca
ccatctctagccaccagaatgcattctggacagcactcaactcaagcacaaagtacaggc
cagggaggtctttctgcaccttcatccttaatatgtcacaatttgtgtgatccagcttca
tttccacctgatgaggcaactgtgaacattaagcctgaacctgaagagcaggaacctaac
ttttcaacaattggtctacaggacatcactttagatgatgtgaacgagataattgggaga
gacatgtcccagatttctgtttcccaaggaacaggggcgagcaggcaggctcccctccct
ggtcccgattccctggatttgggaagatccgatgggctctga

DBGET integrated database retrieval system