KEGG   Parageobacillus thermoglucosidasius DSM 2542: AOT13_00405Help
Entry
AOT13_00405       CDS       T04476                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
ptl  Parageobacillus thermoglucosidasius DSM 2542
Pathway
ptl00071  Fatty acid degradation
ptl00280  Valine, leucine and isoleucine degradation
ptl00281  Geraniol degradation
ptl00362  Benzoate degradation
ptl00592  alpha-Linolenic acid metabolism
ptl01100  Metabolic pathways
ptl01110  Biosynthesis of secondary metabolites
ptl01120  Microbial metabolism in diverse environments
ptl01130  Biosynthesis of antibiotics
ptl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ptl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AOT13_00405
   00592 alpha-Linolenic acid metabolism
    AOT13_00405
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AOT13_00405
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    AOT13_00405
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AOT13_00405
   00642 Ethylbenzene degradation
    AOT13_00405
Enzymes [BR:ptl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     AOT13_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ALF08629
UniProt: A0A1Y3Q1U4
LinkDB All DBs
Position
complement(72247..73419)
Genome map
AA seq 390 aa AA seqDB search
MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVRETLKRAGNYEGNIDDLIIGCAMPE
AEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERIMLGHSDTIIAGGVESM
SLVPMMGHVIRPNAKLAEEAPQYYMSMGHTAEQVAMKYGVSREDQDAFAVRSHQRAAKAI
REGKFKDEIVPVEVTVRKVENNKLVEKTILFEEDEGVRPDTNMETLAKLHPAFSVNGTVT
AGNASQMSDGAAAVMVMDREKAESLGLKLLGKFRSFAVAGVPPEVMGIGPVAAIPKALKL
AGLELSDIGLIELNEAFASQAIQVIRELGLDEEKVNVNGGAIALGHPLGCTGAKLTLSLL
YEMRRRNVQFGIVTMCIGGGMGAAGVFELI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaagcggtgattgttgcgggagcgcgcacgccggtcggaaaggcgaaaaaaggc
acgctcgcccatgtgcggccggatgatttaggcgcgcttgttgtgagggaaacgttgaaa
cgagccgggaattacgaaggaaatatcgatgatcttattattggctgcgcgatgccggaa
gcggagcaagggttaaatatcgcgagaaacataggagcgcttgcaggacttccatacacg
gttccggcgataacgatcaatcgttattgctcgtcgggcttgcaagcgattgcttacgca
gcggagcgcatcatgcttggccattcggatacgatcattgccggcggtgtggaatcgatg
agccttgtcccgatgatggggcatgtaatacgtccaaacgcgaaactggcagaagaagct
ccacagtattatatgtccatgggacatacggcagagcaagtggcgatgaagtatggggtt
agccgggaagaccaagacgcgtttgctgtgagaagccatcagcgcgctgcaaaagcgatc
cgcgaaggcaaattcaaggacgaaattgtcccggttgaagtgaccgttcgcaaagtagaa
aataacaagcttgtcgagaaaacgatacttttcgaagaggatgaaggggtgcgcccggat
acaaatatggaaacgttagcaaaactccatccggcattttccgtaaatggaacggtaacc
gctgggaacgcttcgcaaatgagcgatggcgctgccgctgtcatggtgatggaccgggaa
aaagcagaatcgctagggctaaaattgcttgggaaattccgttcattcgccgtcgccggc
gtgccgccggaagtaatgggaatcggcccggtcgccgcaatcccgaaagcgttaaaactt
gccggcttagaactttctgatatcggattgattgaactaaatgaagcttttgcgtcccag
gcgattcaagtgattcgcgagcttgggcttgatgaggaaaaagtcaatgtcaacggagga
gcaatcgcacttggccacccacttggctgtactggcgcaaaattgacgttgtcattgctc
tatgaaatgcgccgccgcaacgtgcagtttgggattgtcacgatgtgcatcggcggcggc
atgggcgcagcaggggtatttgaattaatttaa

DBGET integrated database retrieval system