Paraburkholderia terricola: CUJ90_20795 Help Entry CUJ90_20795       CDS       T05812                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism pts  Paraburkholderia terricola Pathway pts00362   Benzoate degradation pts00621   Dioxin degradation pts00622   Xylene degradation pts01100   Metabolic pathways pts01120   Microbial metabolism in diverse environments pts01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:pts00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CUJ90_20795    00622 Xylene degradation     CUJ90_20795    00621 Dioxin degradation     CUJ90_20795 Enzymes [BR:pts01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      CUJ90_20795 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Motif Other DBs NCBI-ProteinID:  AXE94814 UniProt:  A0A1M6S128 LinkDB All DBs Position mHS1_B:513169..513399 Genome browser AA seq 76 aa AA seqDB search MPIVTIQVTREGTKPGADSVTANEKAQLIEGVSQLLLDVLNKPLEATFVVIEEVEKENWG WGGLPVDEYRKQRGLK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgccgatcgtcacgattcaggtgacccgcgagggcacgaaaccgggcgccgattccgtc acggcgaatgaaaaggcgcaactcatcgagggagtgagccagctactgctcgacgtgttg aacaagccgctggaggcgacgttcgtcgtcatcgaagaggtggagaaggagaactgggga tggggcgggctgccggtcgacgaatatcgaaagcagcgcggcttgaagtag

DBGET integrated database retrieval system