Pandoraea thiooxydans: ABW99_17185 Help Entry ABW99_17185       CDS       T03947                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism ptx  Pandoraea thiooxydans Pathway ptx00190   Oxidative phosphorylation ptx01100   Metabolic pathways Module ptx_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ptx00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     ABW99_17185  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ptx00194]     ABW99_17185 Photosynthesis proteins [BR:ptx00194]  Photosystem and electron transport system   F-type ATPase [OT]    ABW99_17185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AKJ69686 UniProt:  A0A0G3EY49 LinkDB All DBs Position 64459..64728 Genome browser AA seq 89 aa AA seqDB search MQAFIANIQGLTAIGIGIIIGLGAVGACIGIGLMGGKYIEAAARQPELMNPLQTKMFLLA GLIDAAFLIGVGVAMLFAFANPLLSKLAS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgcaagctttcatcgccaacatccagggtttgaccgccatcggcatcggcatcatcatc ggcctgggtgctgtcggcgcctgtatcggtatcggtttgatgggcggcaaatacattgaa gccgccgcgcgtcagcccgaattgatgaatccgttgcaaaccaagatgttcttgttggcc ggtctgatcgacgcggcattcctgatcggcgtgggcgtggcaatgctgttcgcgtttgcc aacccgctgctctcgaagctcgcttcctga

DBGET integrated database retrieval system