KEGG   Candidatus Pelagibacter ubique: SAR11_0307
Entry
SAR11_0307        CDS       T00257                                 

Gene name
folD
Definition
(GenBank) methylenetetrahydrofolate dehydrogenase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01120  Microbial metabolism in diverse environments
pub01200  Carbon metabolism
pub01240  Biosynthesis of cofactors
Module
pub_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0307 (folD)
Enzymes [BR:pub01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     SAR11_0307 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     SAR11_0307 (folD)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH Stn1 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AAZ21128
UniProt: Q4FNW1
LinkDB
Position
complement(303706..304551)
AA seq 281 aa
MILIDGKKIAAELREQLRQEVVELKAKHNKIPGLTVILIGEMAPSQIYVRMKEKAANEVG
LKSEVIRYPEAVEEKTVLDKIEELNKDESISGILVQLPLPKHIDKQKVIETILPGKDVDG
FHPMNVGNLSSGYESSVPCTPLGCYLMIKKIEPNLSGKKAVMIGRSNLNGKPMAQLLLKE
NCTVTITHSKTKDLKAECLEADIIVAAVGIPELVKADWVKKDAIVIDVGINKTENGIVGD
VAFEEVSKVARALTPVPGGVGPMTIACLLKNTIECFKRSQK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgatcttaatagatgggaaaaaaatagcagctgaacttagagagcaattaagacaagag
gtcgtagagctaaaagctaaacacaataaaattcctgggcttacagttattttaattgga
gaaatggcccctagtcaaatttatgttcgtatgaaagagaaagctgcgaatgaagtaggg
ttaaaatctgaagtaattagataccctgaagctgtggaagaaaaaacagtattagataaa
attgaggaattaaataaagatgaaagtatttcaggaattttagttcaactacctttacca
aaacatatcgataagcaaaaagttattgaaactattttaccaggaaaagatgttgatggg
tttcacccaatgaatgttggaaatctttcttcaggttatgaaagttcagttccttgtact
cctttaggatgttatttaatgattaaaaaaattgaaccaaatttgagtggaaaaaaagct
gttatgattggtagatcaaatttaaacggtaaaccaatggcgcagttacttttaaaagaa
aattgcacagtaacaattactcattcaaagactaaagatttaaaagcagaatgcttggag
gcagatattatagttgctgctgttggcattccagagcttgtgaaagcggactgggttaaa
aaagatgcaattgtaatagatgttgggattaataaaactgaaaacggtattgtcggtgac
gttgcattcgaagaagtttcaaaagttgcaagagctttaacacctgttccaggtggagta
gggccaatgactattgcctgcttgttaaaaaatactattgagtgttttaaaagatctcaa
aaataa

DBGET integrated database retrieval system