KEGG   Candidatus Pelagibacter ubique: SAR11_0319
Entry
SAR11_0319        CDS       T00257                                 

Gene name
purH
Definition
(GenBank) Bifunctional purine biosynthesis protein
  KO
K00602  phosphoribosylaminoimidazolecarboxamide formyltransferase / IMP cyclohydrolase [EC:2.1.2.3 3.5.4.10]
Organism
pub  Candidatus Pelagibacter ubique
Pathway
pub00230  Purine metabolism
pub00670  One carbon pool by folate
pub01100  Metabolic pathways
pub01110  Biosynthesis of secondary metabolites
Module
pub_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:pub00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SAR11_0319 (purH)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SAR11_0319 (purH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pub04147]
    SAR11_0319 (purH)
Enzymes [BR:pub01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.3  phosphoribosylaminoimidazolecarboxamide formyltransferase
     SAR11_0319 (purH)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.10  IMP cyclohydrolase
     SAR11_0319 (purH)
Exosome [BR:pub04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAR11_0319 (purH)
SSDB
Motif
Pfam: AICARFT_IMPCHas MGS Tmemb_18A
Other DBs
NCBI-ProteinID: AAZ21143
UniProt: Q4FNU6
LinkDB
Position
317679..319214
AA seq 511 aa
MKKIKKALISVSDKKDLGSLLRVLAKYKIELISSGGTFKEIKKLKFKCQEVSEYTGSPEI
LGGRVKTLHPKIHAGILSKRNDKSHTKELKANQYDEIDLVIVNFYPFEKTLDQTTNHSKI
IENIDVGGPTMVRAAAKNYNDVTVITSSDQYETLINELENNKGSTSIEFREKMSLEAFSE
TAYYDAVISNYFNKIKKNNFPKKKIIYGNLIEKLRYGENPHQEAAIYSKTQNLNIKQIHG
KQLSYNNYNDIFSALTISKSLPKNSGTVIVKHANPCGVSINKNSLKSYKLALASDPVSAF
GGIVSCNFKINKTLALELNKIFLEVIIANGFQADALKILKKKKNIRIIDASEFMMKDLIR
FGSVNESILTQSEDLKVFEPKDFKVVSKLRPNKSQLKNLIFAFNVCRYVKSNAIVLASQE
ATVGIGSGQPSRLDSCQIAIDKMNKFQNLKEDIVAASDAFFPFVDGIEKLVQSGVSAVIQ
PSGSIRDKEIIKFANQTGTILVFSKTRHFRH
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgaaaaaaataaaaaaagctcttatttcagtatctgataaaaaagatttaggcagtctt
ttaagagttttagcgaaatacaaaattgaattaattagctctggaggcacctttaaagaa
ataaagaaacttaaatttaaatgccaagaagtttcagagtatactggttcaccagaaatt
cttggtggaagagttaaaacgctacacccaaaaattcatgctggtatattaagtaaaaga
aacgacaaatctcacactaaagaactaaaagctaatcaatatgatgaaattgaccttgtt
attgttaacttttatccttttgaaaaaactttagatcaaacaaccaatcattcaaaaata
atagagaatattgatgttggaggtcccactatggttagggcagctgccaaaaactataac
gatgttactgttattacatcctcagatcaatatgaaaccttaattaatgaattggaaaat
aataaaggatcaacatctattgaatttagagaaaagatgtctttagaggccttttctgaa
acagcttattatgatgctgtaatttctaactattttaataaaattaaaaaaaacaatttt
cccaaaaaaaaaattatttatggaaatttaattgaaaaattaagatatggtgaaaatcca
catcaagaagctgccatttattctaaaactcaaaatcttaatattaaacaaattcatggt
aagcagttaagttataataattataatgatattttttctgcattaacaatatcaaaatct
ttaccaaaaaactccggaaccgttatagttaaacatgctaatccttgtggtgtttcgatt
aataaaaatagtttgaaaagttataaattggctcttgcttctgatccagttagcgctttt
ggaggaatagtttcttgtaatttcaaaataaataaaactctagcattggagcttaataaa
attttcttagaggttatcattgctaatggttttcaagctgatgctttaaaaattttaaaa
aagaaaaaaaatataagaattattgatgcatcagaatttatgatgaaagatttaattaga
tttggctctgtgaatgaatctatattaactcaatctgaggatttaaaagtttttgaacct
aaagattttaaagttgtttcaaaactaagaccaaataaatctcaattaaaaaatttaatt
tttgcatttaatgtttgtagatatgtaaaatcaaatgcaattgttcttgcaagccaagaa
gcaactgttggtattggctcagggcaacctagtagacttgatagctgtcaaattgctata
gataaaatgaataaatttcaaaacttaaaagaagatattgtggcagcctctgatgcattt
tttccatttgttgatggtattgaaaaattagtacaatcaggagtttcagctgtaatacag
ccttctggatcaattagagataaggagataataaaatttgcaaaccaaactggtactatt
ttagttttctctaaaacaagacattttagacattaa

DBGET integrated database retrieval system