KEGG   Pelosinus sp. UFO1: UFO1_1504Help
Entry
UFO1_1504         CDS       T03211                                 

Definition
(GenBank) Thioredoxin-disulfide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
puf  Pelosinus sp. UFO1
Brite
KEGG Orthology (KO) [BR:puf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UFO1_1504
Enzymes [BR:puf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     UFO1_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored Pyr_redox NAD_binding_8 Thi4 K_oxygenase DAO Lycopene_cycl FAD_binding_3 FMO-like Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AIF51055
UniProt: A0A075KA82
LinkDB All DBs
Position
1682145..1683056
Genome map
AA seq 303 aa AA seqDB search
MYDLIIIGGGPAGLTAAVYAARKKMDTLLLTKEFGGQLMWTKEIENYMGYQFISGPELMS
KFEEQVKRFSVLTKYEEVNSLKVRDDGTFLIKTEEGEYEGKTVIAAMGKRPRRLEVPGEI
EFTGRGVSYCATCDGPLFADKVVAVVGGGNSAVQAALELSGIAPTVYLIVRNNTYNADPI
LLDKMKAAKNIVEMKGYISTGIFGDELVEKISISEIASGKTQDLAVEGVFVEVGLEPNSE
FLEDIVAMNQEGELVVDCRSKTNIPGLYAAGDVTNGPDKQIVIAAGDGAKSALMAYDYLL
HRK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatttaattattattggtggcggaccagcaggactaacggcagctgtatatgca
gcacgtaaaaagatggataccctattattaacaaaagaatttggcggacagcttatgtgg
acaaaagaaattgaaaattatatgggatatcaatttattagcggccctgagctgatgagt
aaatttgaagagcaggtaaaacgcttttccgtattaacaaaatacgaagaagtaaatagt
ctaaaagtgagagatgatggcaccttcttaattaagacagaggagggcgaatacgaaggt
aaaacggtcattgcggcaatgggtaagcgtccaagaagattagaggtacctggggaaatt
gagttcactggtcgaggcgttagttattgcgctacttgtgatgggcctttgtttgctgat
aaggtagtagctgttgtaggaggcggtaattctgctgtccaggcagccttagaacttagt
ggtatagctcccactgtatatttaatagttcggaataatacttataatgcggatccaata
cttctagataagatgaaagcagctaagaatatagttgaaatgaaaggttatatttcaacg
gggatttttggtgatgaattagttgaaaaaatctcaattagcgaaattgcctcaggaaaa
actcaagatttggccgtagaaggtgtcttcgtagaggtcggcttagaacctaactctgaa
tttctagaagatatagtagcaatgaatcaagaaggggaactggttgtcgattgtcgttct
aaaaccaatattcctggattatatgcagcaggagatgtaacaaatggtcccgataaacaa
attgtaattgcagctggagatggcgctaagtcggctcttatggcttatgattatttgcta
catagaaaataa

DBGET integrated database retrieval system