KEGG   Pusillimonas sp. ye3: CKA81_10015Help
Entry
CKA81_10015       CDS       T05795                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pus  Pusillimonas sp. ye3
Brite
KEGG Orthology (KO) [BR:pus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKA81_10015
Enzymes [BR:pus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKA81_10015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 DAO HI0933_like FAD_oxidored FAD_binding_3 K_oxygenase Glutaredoxin Thi4 NAD_binding_8 AlaDh_PNT_C FMO-like
Motif
Other DBs
NCBI-ProteinID: QAA94125
UniProt: A0A410GCX1
LinkDB All DBs
Position
complement(2085984..2087582)
Genome map
AA seq 532 aa AA seqDB search
MLDATLKTQLNSYMEMLRQPIEIVAYLDDSQKSTELRDLLREIDGMSDKITLSERDDDNQ
RKPSFSINRSGTDISVQFAGIPMGHEFTSLVLALLQVGGHPIKLDETVIEQIRNLDGDYA
FETYFSLSCQNCPDVVQALNTMSIINPRIRHVAIDGALYQDEVDARQIMSVPTMFLNGDV
FGQGRSSVEEILARLDTGAADRKAQELNAKDPYDVLIVGGGPAGAAAAVYAARKGIRTGV
VAERFGGQVLDTMAIENFISVKETDGPKFAAALEQHVQAYDVDIMNLQQATELVPGKLTE
IKLANGGSLKARTVILATGARWREINVPGERQYRNNGVAYCPHCDGPLFKGKRVAVIGGG
NSGVEAAIDLAGLVKHVTLIEYGSALRADAVLQRKLNSMPNVTIITSAQTTEINGDGKKV
SSLTYQDRADKEIHTIELEGVFVQIGLVPNTEWLKGGAVALSKHGEIEIDARGQTSVPGV
FAAGDCTTVPYKQIVISAGDGAKAALSAFDHLIRTSVSEVEEAVSQAETAAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgcaactttgaaaacgcaattgaactcctatatggaaatgctcaggcagccg
atcgagatcgttgcctatttggacgacagccaaaaatcgacagagctgcgcgatctgctg
cgcgaaatcgatggcatgtcggacaagatcaccctgagcgagcgtgatgacgacaaccag
cgcaagccttcattcagcatcaatcgcagcgggaccgatatcagcgtgcagttcgcgggc
attcccatggggcacgagttcacctcattggtcctggcactgctgcaggtaggcggccat
cctatcaagctggatgagaccgtgattgaacagattcgtaatcttgatggcgattacgcc
ttcgagacctatttttcgctgtcatgccagaactgcccggatgtggttcaggcgcttaat
acgatgtccatcatcaacccgcgtatccgccacgtggcgattgacggggccctgtatcag
gacgaggtcgacgcacgccagatcatgtcggtgcccaccatgtttctgaacggcgacgtc
ttcggccaggggcgctccagcgtggaagagatcctggccaggctggacaccggcgcggcc
gatcgcaaggcgcaagagctcaacgccaaagatccttacgacgtccttattgtgggcggc
gggccggcaggcgcagcagctgcggtttacgcggcccgcaagggtatccgtaccggcgtg
gtggccgagcgttttggtggccaggtgctcgacaccatggccatcgagaacttcatttcc
gtcaaggaaaccgatggccccaagttcgcagcggcgctcgagcaacacgtgcaggcttat
gacgtagacatcatgaacctgcagcaggccactgaactggttcctggcaagctgaccgaa
atcaagctggccaacggtgggtcgctgaaggcgcgtacggtcatattggccacgggtgcc
cgctggcgcgaaatcaatgtgccgggcgagcgccagtatcgcaacaacggcgtggcttat
tgcccgcattgcgacggtccattgtttaagggcaagcgggtcgcggtcattggcggcggc
aactcgggtgttgaggccgccatcgacctggcaggcctggtcaagcatgtaacgcttatc
gagtatggcagcgccttgcgggctgacgccgttttgcagcgtaagctcaactctatgccc
aacgtcaccatcatcacttcggcccaaaccaccgagatcaatggcgacggcaagaaggta
agcagcctgacctatcaagatcgtgcggacaaggaaatccacaccatcgagctggaaggg
gtgtttgtgcagatcggcctggtgcctaataccgagtggctgaagggtggggcggtagcc
ctgtccaagcacggcgaaatcgaaatagacgcgcggggccaaacctccgtgccgggtgtt
ttcgccgcgggggactgcacgaccgtgccctacaagcagatcgtgatttctgccggcgat
ggtgccaaggcagccttaagcgccttcgatcacctgatccgtacgtcggtgtccgaagtc
gaagaggcggtcagtcaagccgagacagccgcagcctaa

DBGET integrated database retrieval system